BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K07 (585 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_55935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) 29 2.8 SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04) 29 3.7 SB_9756| Best HMM Match : Cadherin (HMM E-Value=0) 29 3.7 SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) 28 6.4 SB_26795| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) 28 6.4 SB_53706| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_34782| Best HMM Match : zf-CHY (HMM E-Value=0.36) 27 8.5 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 27 8.5 >SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 31.1 bits (67), Expect = 0.69 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 120 TRVSLTPLCNNTAVSITSNDSPPFNNAD 203 T+ S TP+C + A T+N SP N++D Sbjct: 570 TQSSATPMCQSGATDTTNNQSPAVNSSD 597 >SB_55935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1485 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 101 DRNQNHFVVIDSSSRWYLCHSRTDIKFK 18 DR+ FV ++W +CH RTD+ K Sbjct: 851 DRSVEAFVYTVLGAQWRVCHPRTDVHLK 878 >SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 277 KRNAEVTSSAPS*INYSSKDNQTSSNTLTVSGTDP 381 + N +VT P ++YSS D+ N GT+P Sbjct: 820 RHNDDVTDKKPRLVDYSSADSSDHDNAADNKGTEP 854 >SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) Length = 317 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 72 DDDKMILITVVLSA-LVTRVSLTPLCNNTAVSITSNDSP 185 DDD L ++ A L S TPLC + + +I DSP Sbjct: 61 DDDPASLANIINEAFLAPMASFTPLCADASPTIPPTDSP 99 >SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 447 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 72 DDDKMILITVVLSALVTRV-SLTPLCNNTAVSITSNDSP 185 DDD L ++ A ++ + S TPLC + + +I DSP Sbjct: 111 DDDPASLANIINEAFLSPMASFTPLCADASPTIPPTDSP 149 >SB_9756| Best HMM Match : Cadherin (HMM E-Value=0) Length = 608 Score = 28.7 bits (61), Expect = 3.7 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +3 Query: 114 LVTRVSLTPLCNNTAVSITSNDSPPFNNADPVMQL-YNSVIVSDYKAAVKTTFQLEKECR 290 + T +P + V IT ND N+ PV + Y V+VS+Y +T +L Sbjct: 356 IATDNGTSPRSAHARVHITVND---VNDNRPVFEPPYYQVMVSEYAPVGQTILRLTVSDN 412 Query: 291 SDVISSVVNKLLLEGQPN 344 +S +N ++ G PN Sbjct: 413 DTAENSQLNLRVVSGDPN 430 >SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) Length = 558 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +3 Query: 51 IPSRRRIDDDKMILITVVLSALVTRVSLTPLCNNTAVSITS 173 +P RR +M+++ + +++R++L+P C+N S+ S Sbjct: 375 LPPLRRDYTHQMVVVAPLKVKMISRLTLSPTCSNKPHSLPS 415 >SB_26795| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) Length = 609 Score = 27.9 bits (59), Expect = 6.4 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 273 LEKECRSDVISSVVNKLLLE-GQPNVVEYAYSLWYRSGEDIVKVYFPIE 416 L RSD+ + L++E +PN + + WYR + VK++ E Sbjct: 245 LSHTLRSDLADPYLEMLIIEIKKPNTKPFLIATWYRPPKSSVKLFESFE 293 >SB_53706| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 27.9 bits (59), Expect = 6.4 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -2 Query: 575 RI*FPAHSRPGLRLTRTE*RSVASVIGLQFKLESK 471 RI P H+ L TE ++ASV GL FK E + Sbjct: 287 RITIPCHNNHALAELPTEPPAIASVHGLDFKAEEE 321 >SB_34782| Best HMM Match : zf-CHY (HMM E-Value=0.36) Length = 967 Score = 27.5 bits (58), Expect = 8.5 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -2 Query: 101 DRNQNHFVVIDSSSRWYLCHSRTDIK 24 DR HF V+ W++ H R ++ Sbjct: 163 DRRYRHFTVVGXXXXWWVSHERESLR 188 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 27.5 bits (58), Expect = 8.5 Identities = 19/92 (20%), Positives = 39/92 (42%), Gaps = 3/92 (3%) Frame = +3 Query: 72 DDDKMILITVVLSALVTRVSL-TPLCNNTAVSITSNDSPPFNNADPVMQL--YNSVIVSD 242 DDD L ++ A + ++ TPLC + + +I DSP + +L N+ + Sbjct: 290 DDDPASLANIINEAFLAPMAFFTPLCADASPTIPPTDSPSVTELGVLKKLSSLNTTKATR 349 Query: 243 YKAAVKTTFQLEKECRSDVISSVVNKLLLEGQ 338 + + + ++S++N EG+ Sbjct: 350 PDGVPGWLLKENADLLAPAVTSIINTSFAEGR 381 >SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 165 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +3 Query: 279 KECRSDVISSVVNKLLLEGQPNVVEYAYSLWYRSGEDIVKVYFPIEFRLLFNEDP 443 K C + SV N G P++ +Y + WYR+ E ++ F +F +P Sbjct: 96 KICDFGLARSVSNITQEAGDPSLTDYVATRWYRAPEILLASPRKATFSWIFYIEP 150 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,520,957 Number of Sequences: 59808 Number of extensions: 280736 Number of successful extensions: 883 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -