BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K06 (307 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 25 0.24 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 1.3 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 21 2.9 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 2.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 3.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 3.8 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 20 6.7 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 19 8.8 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 24.6 bits (51), Expect = 0.24 Identities = 12/46 (26%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 44 ITINNNKLSNMKYNVSK--NVSVHSYGYNISTKTCVLFYYAGCRGN 175 + ++N K+ + + K + S+G ++T +LF Y G GN Sbjct: 346 VQVSNKKIKFSSFGMLKISRSLLTSFGGALTTFLVILFQYGGIHGN 391 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.2 bits (45), Expect = 1.3 Identities = 6/19 (31%), Positives = 17/19 (89%) Frame = +2 Query: 44 ITINNNKLSNMKYNVSKNV 100 +++ N+K++N+++NV+K + Sbjct: 528 LSMANDKVANVRFNVAKTL 546 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 21.0 bits (42), Expect = 2.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 206 EETCNVH*TDINLLR 250 EETC +DINL++ Sbjct: 23 EETCETLMSDINLIK 37 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.0 bits (42), Expect = 2.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 71 NMKYNVSKNVSVHSY 115 +M NVS N+++H Y Sbjct: 146 SMSVNVSMNMTMHGY 160 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 3.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 17 ITKFDSGCQITINNNKLSNMKYNVSKNVS 103 +T F G + T+ NN N NVS Sbjct: 1135 VTTFMEGSKATVKNNVEDNYMEAPQDNVS 1163 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 3.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 17 ITKFDSGCQITINNNKLSNMKYNVSKNVS 103 +T F G + T+ NN N NVS Sbjct: 1135 VTTFMEGSKATVKNNVEDNYMEAPQDNVS 1163 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 19.8 bits (39), Expect = 6.7 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = +2 Query: 77 KYNVSKNVSVHSYGYN 124 K ++ +H YGYN Sbjct: 382 KADIKMYADMHQYGYN 397 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 19.4 bits (38), Expect = 8.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 223 NVASFLTLKLGVETIGV 173 N+AS TLKL + I + Sbjct: 186 NIASSKTLKLSINIISL 202 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,849 Number of Sequences: 336 Number of extensions: 912 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5518292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -