BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K05 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 27 0.39 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 6.3 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 27.1 bits (57), Expect = 0.39 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = -3 Query: 154 VLLKPFIACTNSWCNMSPYL----FCFPYLHYSID*RLFTLETCCGYGY 20 V FI CT WC++ Y+ F + + L T+ET GYGY Sbjct: 285 VFFVQFIQCTMIWCSLILYIAVTGFSSTVANVCVQIILVTVET-YGYGY 332 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 6.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 99 YGDMLHHEFVQAMNGFNKTTKHNKGLY 179 Y D+ F + M GF+ TK K +Y Sbjct: 1120 YDDVRKKRFTEFMRGFHIITKKLKEMY 1146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 349,520 Number of Sequences: 2352 Number of extensions: 5228 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -