BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_K02 (460 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 30 0.15 SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 26 2.4 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 26 3.2 SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 26 3.2 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 25 4.2 SPBC3E7.09 |||Sad1-UNC-like C-terminal|Schizosaccharomyces pombe... 25 7.3 SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy... 25 7.3 SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces... 24 9.7 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 24 9.7 SPBC119.11c |pac1|hcs|double-strand-specific ribonuclease Pac1|S... 24 9.7 SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 24 9.7 SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|S... 24 9.7 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 30.3 bits (65), Expect = 0.15 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 85 NSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPI 192 N V DG + VVI P F+ P+N S N+ P+ Sbjct: 402 NHSVTGDGEAKQVVITMPSTHFT-PANNSSANHSPL 436 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 26.2 bits (55), Expect = 2.4 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 118 HVVIANPDPFFSQPSNGPSGNY-EPISTGPAF-VDFNHPNYPPKRYDNP 258 HV ++NPD P + S NY P+ A +F+ P + +Y +P Sbjct: 478 HVSLSNPDFAIGSPMSQDSSNYSSPLHRRKASDSNFSDPRFDDLKYLSP 526 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.8 bits (54), Expect = 3.2 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = +1 Query: 145 FFSQPSNGP----SGNYEPISTGPAFVDF 219 F + P+N P SG+Y PI P F F Sbjct: 1560 FVTPPTNSPYAEVSGDYNPIHVSPTFAAF 1588 >SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 25.8 bits (54), Expect = 3.2 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 175 GNYEPI--STGPAFVDFNHPNYPPKRYDNPLAR 267 G+Y P ST P + +P+YPP Y AR Sbjct: 117 GSYPPTQPSTQPLPQSYGYPSYPPAGYRGGSAR 149 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 25.4 bits (53), Expect = 4.2 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 151 SQPSNGPSGNYEPISTGPAFVDFNHPNYPP 240 S P N P P+S PA + P PP Sbjct: 265 SSPPNSPPRPIAPVSMNPAINSTSKPPLPP 294 >SPBC3E7.09 |||Sad1-UNC-like C-terminal|Schizosaccharomyces pombe|chr 2|||Manual Length = 659 Score = 24.6 bits (51), Expect = 7.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -1 Query: 109 CRPMEHHYCPPRELCLRQP 53 C P H+C LCL+ P Sbjct: 25 CSPQTSHWCKYPALCLKSP 43 >SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 433 Score = 24.6 bits (51), Expect = 7.3 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 295 YLYETFTSHHGREGCRIAWVDNWD 224 Y+Y++ + R WV+NWD Sbjct: 55 YIYKSNPGMEIKNAIRNGWVENWD 78 >SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 24.2 bits (50), Expect = 9.7 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 145 FFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 249 + +Q GPS NY + V+ +PNY + Y Sbjct: 151 YIAQLVGGPSINYSTAAMLLGAVNIGNPNYEVQNY 185 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 24.2 bits (50), Expect = 9.7 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 100 SDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 210 SD DH V + P F S+ P + E S P F Sbjct: 1443 SDVEDDHDVAKSTAPDFETSSHRPERSSEKKSPSPVF 1479 >SPBC119.11c |pac1|hcs|double-strand-specific ribonuclease Pac1|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 24.2 bits (50), Expect = 9.7 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +1 Query: 139 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 240 +P +PS+ P + P +F YPP Sbjct: 99 EPVIEEPSSHPKNQKNQENNEPTSEEFEEGEYPP 132 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 24.2 bits (50), Expect = 9.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 140 SGFAITTWSLLPSDGTPLL 84 S F + W++LP G P+L Sbjct: 899 SCFVLRIWNMLPETGVPIL 917 >SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|Schizosaccharomyces pombe|chr 3|||Manual Length = 624 Score = 24.2 bits (50), Expect = 9.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 120 RCYCEPGSFLLSTIKRS*RKL*THKHWTGVRR 215 +C EP S STI+ HW G+R+ Sbjct: 444 KCLTEPTSRFQSTIEIQKHPFFKRLHWNGLRK 475 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,710,945 Number of Sequences: 5004 Number of extensions: 31551 Number of successful extensions: 82 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -