BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J20 (225 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498,162... 30 0.29 07_01_1145 - 10742757-10743085,10744784-10744865 29 0.38 12_01_0988 - 10039187-10039243,10039356-10039649,10039838-100402... 29 0.51 06_03_1490 + 30497980-30498102,30499034-30500156,30500914-305011... 29 0.51 10_02_0023 + 4306350-4306908,4308429-4308814,4308917-4308991,430... 29 0.67 07_03_1707 + 28866054-28866065,28866185-28866269,28866398-28867149 29 0.67 08_02_0282 - 15274413-15274465,15274564-15275245 28 1.2 06_03_0149 + 17260632-17260647,17263368-17264071 28 1.2 01_06_1067 + 34258036-34258051,34264808-34265679 28 1.2 09_02_0065 + 3799748-3800182 27 1.5 05_07_0274 - 28873531-28873644,28873727-28873981,28874111-288741... 27 1.5 03_03_0094 + 14378953-14380728 27 1.5 11_06_0710 - 26492093-26493460 27 2.0 11_01_0373 + 2826646-2826676,2827010-2827268,2828325-2828415 27 2.0 01_05_0279 + 20318440-20318688,20318785-20318931,20319449-203196... 27 2.0 02_04_0516 + 23593088-23593116,23593209-23593336,23593527-235937... 27 2.7 11_04_0375 + 16933688-16933703,16936291-16937063 26 4.7 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 26 4.7 05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237,364... 26 4.7 04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309,391... 26 4.7 01_06_0230 + 27718840-27720188,27720983-27721174,27721488-277215... 26 4.7 12_02_0122 + 13923510-13925081 25 6.2 07_01_0463 + 3502708-3503535 25 6.2 06_01_0159 + 1193479-1194435,1194509-1194652,1194735-1194821,119... 25 6.2 05_01_0335 + 2652334-2652340,2652459-2652550,2652642-2653362,265... 25 6.2 03_06_0326 + 33150599-33150907,33151013-33151104,33151961-331520... 25 6.2 03_02_0999 - 13105030-13105434,13105716-13105850,13105933-131061... 25 6.2 03_02_0998 - 13097675-13098079,13098307-13098441,13098522-130987... 25 6.2 01_01_0090 + 706340-707296,707370-707513,707596-707682,707771-70... 25 6.2 01_01_0089 - 699533-699643,699738-700046,700134-700220,700298-70... 25 6.2 12_01_0513 + 4059586-4059620,4060155-4060365,4060470-4060724,406... 25 8.2 11_02_0027 - 7504076-7504904,7505024-7505219,7505401-7505467 25 8.2 08_01_0068 + 471729-472460,472578-472655,473270-473507,474130-47... 25 8.2 07_03_1188 + 24671022-24672482 25 8.2 02_01_0024 + 159595-159801,159892-160017,160201-160338,160431-16... 25 8.2 >02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498, 1625603-1625887,1626016-1626030,1626339-1626419, 1626909-1627322,1627423-1627719,1627801-1629864 Length = 3057 Score = 29.9 bits (64), Expect = 0.29 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 3/66 (4%) Frame = +1 Query: 19 DEVEEKKPSKGKSRQKVKDRL---SLDQNKYGKNKKKQFNQFIVEEGQGNAEKLQKRAER 189 D++ K S+ + ++V L SL +N++G ++ + ++E GNAEKL A+ Sbjct: 2662 DDITSPKASQEDALEEVGTELPHESLHENRHGAKDEQTLS--LIEPDTGNAEKLPNEADS 2719 Query: 190 FAGGAC 207 C Sbjct: 2720 VQSPPC 2725 >07_01_1145 - 10742757-10743085,10744784-10744865 Length = 136 Score = 29.5 bits (63), Expect = 0.38 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = +1 Query: 25 VEEKKPSKGKSRQKVKDRLSLDQNKYGKNKK 117 VEE++ K K +QK+KDRL+L N + K KK Sbjct: 63 VEEEERQKAK-KQKIKDRLNL-TNAFDKGKK 91 >12_01_0988 - 10039187-10039243,10039356-10039649,10039838-10040202, 10042916-10042931 Length = 243 Score = 29.1 bits (62), Expect = 0.51 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 4/54 (7%) Frame = +1 Query: 25 VEEKKPSKGKSRQKVKDRLSLDQNKYGKNKK----KQFNQFIVEEGQGNAEKLQ 174 VEE++ K + +QK+KDRL+L N + K KK + N+ EG+ N E ++ Sbjct: 141 VEEEERQKAE-KQKIKDRLNL-TNAFDKGKKVYQGESSNKNSEPEGEQNQEGIK 192 >06_03_1490 + 30497980-30498102,30499034-30500156,30500914-30501132, 30501228-30501454,30501810-30501884,30502250-30502321, 30502765-30502863,30502975-30503046,30503131-30503245, 30503455-30503523,30503625-30503952,30504320-30504437, 30504522-30505448 Length = 1188 Score = 29.1 bits (62), Expect = 0.51 Identities = 15/45 (33%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = +1 Query: 67 VKDRLSLDQNKYGKNKKKQ---FNQFI-VEEGQGNAEKLQKRAER 189 V +LS+D+ + + ++K+ +N + +++G GN EKLQ+RA + Sbjct: 631 VASKLSMDEATFREIQEKKLEIYNAIVKLQKGDGNDEKLQERANQ 675 >10_02_0023 + 4306350-4306908,4308429-4308814,4308917-4308991, 4309330-4309539,4309649-4309961,4310035-4310130, 4310220-4310357,4310436-4310536,4310645-4310712, 4310800-4310849,4311790-4311848,4312399-4312530 Length = 728 Score = 28.7 bits (61), Expect = 0.67 Identities = 15/49 (30%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +1 Query: 31 EKKPSKGKSRQKVKDRL-SLDQNKYGKNKKKQFNQFIVEEGQGNAEKLQ 174 +++PSK KSR+ + +L S D+ + GK+K K N+ +++ N + ++ Sbjct: 504 DERPSK-KSRESGESKLTSQDEGEVGKSKSKSVNERPLKKASKNRDDVK 551 >07_03_1707 + 28866054-28866065,28866185-28866269,28866398-28867149 Length = 282 Score = 28.7 bits (61), Expect = 0.67 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 28 EEKKPSKGKSRQKVK-DRLSLDQNKYGKNKKKQFNQFIVEEGQGNAEKLQK 177 EEKKP + K +K + + ++ K + +KK+ ++ EEG+ +K +K Sbjct: 86 EEKKPDQAKKEEKKQPEEKKPEEKKKSEEEKKKGDEKKPEEGKKEEKKEEK 136 >08_02_0282 - 15274413-15274465,15274564-15275245 Length = 244 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +1 Query: 25 VEEKKPSKGKSRQKVKDRLSLDQNKYGKNKK 117 VEE++ K + +QK+KDRL+L N + K KK Sbjct: 139 VEEEERQKAE-KQKIKDRLNL-TNAFDKGKK 167 >06_03_0149 + 17260632-17260647,17263368-17264071 Length = 239 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +1 Query: 25 VEEKKPSKGKSRQKVKDRLSLDQNKYGKNKK 117 VEE++ K + +QK+KDRL+L N + K KK Sbjct: 204 VEEEERQKAE-KQKIKDRLNL-TNAFDKGKK 232 >01_06_1067 + 34258036-34258051,34264808-34265679 Length = 295 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +1 Query: 25 VEEKKPSKGKSRQKVKDRLSLDQNKYGKNKK 117 VEE++ K + +QK+KDRL+L N + K KK Sbjct: 201 VEEEERQKAE-KQKIKDRLNL-TNAFDKGKK 229 >09_02_0065 + 3799748-3800182 Length = 144 Score = 27.5 bits (58), Expect = 1.5 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +1 Query: 19 DEVEEKKPSKGKSRQKVKDRLSLDQ--NKYGKNKKKQFNQFIVEEGQGNAEKLQKR 180 D +EKK G+ R++ KDR + + + G+ +K++ + + G G + +KR Sbjct: 29 DREKEKKKKIGRRRKRKKDREKIGRGGGEIGRRRKRKRDWEKIGRGGGEIGRRRKR 84 >05_07_0274 - 28873531-28873644,28873727-28873981,28874111-28874179, 28874277-28874415,28874511-28875076,28875225-28875326, 28875425-28875491,28875576-28876072,28876148-28876212, 28876470-28876567,28876652-28876694,28876870-28876963, 28877325-28877360,28877454-28877542,28877667-28877788, 28878193-28878404 Length = 855 Score = 27.5 bits (58), Expect = 1.5 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +1 Query: 4 SSTSSDEVEEKKPSKG-KSRQKVKDRLSLDQNKYGKNKKKQFN 129 +S S + +EK+ S+ +S++K K+R +NK K + KQ N Sbjct: 749 NSESPESKKEKENSENPESKEKEKERKENSENKEEKTENKQDN 791 >03_03_0094 + 14378953-14380728 Length = 591 Score = 27.5 bits (58), Expect = 1.5 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +1 Query: 16 SDEVEEKKPSKGKSRQ---KVKDRLSLDQNKYGKNKKKQFNQFIVEEGQGNAEKLQKRAE 186 S++ ++KK K +S +VK LS + + KKK+ E G AEK +K+ E Sbjct: 520 SEKKKKKKKDKAESAYADGEVKAELSDGEKGGSEKKKKKKKSKEGEAGDDEAEKSEKKKE 579 Query: 187 R 189 + Sbjct: 580 K 580 >11_06_0710 - 26492093-26493460 Length = 455 Score = 27.1 bits (57), Expect = 2.0 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +1 Query: 19 DEVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQFNQFIVEEGQGNAEKLQKRAE 186 ++ EKK K K + K K D + K+KKK N E+ + ++K K + Sbjct: 130 EDESEKKKKKKKKKSKSKSSDDDDDDAEKKSKKKSKNSDDDEDDKKKSKKKPKNPD 185 >11_01_0373 + 2826646-2826676,2827010-2827268,2828325-2828415 Length = 126 Score = 27.1 bits (57), Expect = 2.0 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 46 KGKSRQKVKDRLSLDQNKYGKNKKKQFNQFIVEEGQGNAE-KLQKRAERFAGGAC 207 K K++ KVK + +NK K KKK+ + EE + ++ + QK + G C Sbjct: 44 KKKAKAKVKKKPKKKKNKKAKKKKKKKKKKKKEEEEEESDVRQQKYTKVSCKGGC 98 >01_05_0279 + 20318440-20318688,20318785-20318931,20319449-20319611, 20319770-20319887,20320607-20320676,20320774-20320854, 20320924-20320959,20321129-20321149,20321586-20321642, 20321716-20321827,20321905-20322178,20322454-20322556, 20323244-20323459,20324615-20324665,20325339-20327963 Length = 1440 Score = 27.1 bits (57), Expect = 2.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 13 SSDEVEEKKPSKGKSRQKVKDRLSLDQNKY 102 SSDE+ K KGKS ++ +DR+ + K+ Sbjct: 1407 SSDELWRKLEIKGKSNKRNEDRMKISHVKW 1436 >02_04_0516 + 23593088-23593116,23593209-23593336,23593527-23593714, 23593861-23593919,23594997-23595345,23596081-23596333, 23596404-23597476 Length = 692 Score = 26.6 bits (56), Expect = 2.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 25 VEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQ 123 V +KK K K ++K K + +NK K KKK+ Sbjct: 66 VMKKKKKKKKKKKKKKKKKKKKKNKKKKKKKKK 98 >11_04_0375 + 16933688-16933703,16936291-16937063 Length = 262 Score = 25.8 bits (54), Expect = 4.7 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 25 VEEKKPSKGKSRQKVKDRLSLDQNKYGKNK 114 VEE++ K +QKVKDRL+L N + K K Sbjct: 204 VEEEERQKA-GKQKVKDRLNL-TNAFDKGK 231 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 25.8 bits (54), Expect = 4.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 8 PHLVMKLRKKNPLKVNHVRKLKTGYHWT 91 PH V KL + P+ VR +K YH T Sbjct: 108 PHAVYKLLENMPMPWEQVRHVKILYHIT 135 >05_01_0460 - 3644229-3644420,3644623-3644865,3644959-3645237, 3645328-3645525,3645614-3646249,3646352-3646606, 3646718-3646824,3646909-3650705,3650816-3651305, 3652043-3652433,3652621-3652713,3652818-3652941, 3653871-3654118 Length = 2350 Score = 25.8 bits (54), Expect = 4.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 8 PHLVMKLRKKNPLKVNHVRKLKTGYHWT 91 PH V KL + P+ VR +K YH T Sbjct: 108 PHAVYKLLENMPMPWEQVRHVKILYHIT 135 >04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309, 3914729-3914823,3914854-3915213 Length = 1428 Score = 25.8 bits (54), Expect = 4.7 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 61 QKVKDRLSLDQNKYGK--NKKKQFNQFIVEEGQGNAEKLQKRAERFAGG 201 QK+ D+ ++KY + KK++ QF ++G +L R + G Sbjct: 212 QKLVDKAIRQEDKYNRMEQKKRRIAQFKTQQGNNQKPRLTLRPQSMPHG 260 >01_06_0230 + 27718840-27720188,27720983-27721174,27721488-27721569, 27721651-27721839,27721964-27722077,27722470-27722560, 27722632-27722789,27723401-27723826,27724355-27724727, 27725075-27725238 Length = 1045 Score = 25.8 bits (54), Expect = 4.7 Identities = 15/52 (28%), Positives = 31/52 (59%), Gaps = 6/52 (11%) Frame = +1 Query: 22 EVEEKKPSKGK-----SRQKVKDRLSLDQNKYGKNKKKQFN-QFIVEEGQGN 159 +VE+++ +GK R+ V+ +S D+ KN++KQF Q +++ +G+ Sbjct: 194 DVEKRRGRQGKVDEYVQRRIVRGEISEDEGNVDKNERKQFTLQLKMKDTRGS 245 >12_02_0122 + 13923510-13925081 Length = 523 Score = 25.4 bits (53), Expect = 6.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 4 SSTSSDEVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKK 117 ++ ++ E EE K +KG K K++ + + GK+K+ Sbjct: 475 ANKAAKEDEEAKAAKGIEEMKTKEQATTNGEDEGKDKR 512 >07_01_0463 + 3502708-3503535 Length = 275 Score = 25.4 bits (53), Expect = 6.2 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +1 Query: 22 EVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQFNQFIVEEGQGNAEK 168 E++EKK K +++ K + D+ + K +KK+ +EG+ +K Sbjct: 108 EMKEKKKDKSDKKEEGKKKKDGDEEEGKKKEKKKDKDGDEKEGKKEKKK 156 >06_01_0159 + 1193479-1194435,1194509-1194652,1194735-1194821, 1194910-1195244,1195600-1195840,1195921-1195995, 1196072-1196157,1196591-1196663,1196805-1197535, 1197613-1197784,1197862-1197948,1198255-1198344, 1198439-1198549 Length = 1062 Score = 25.4 bits (53), Expect = 6.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 7 STSSDEVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQ 123 S S +E E+ K K +QK R L +NK K K++ Sbjct: 377 SRSYNECEKVKVQKVSGKQKKNKRTRLGKNKGEKGDKEE 415 >05_01_0335 + 2652334-2652340,2652459-2652550,2652642-2653362, 2653456-2653533,2653658-2653684,2653871-2653938, 2654089-2654174,2654251-2654333,2654478-2654620, 2654709-2654810,2654906-2655199,2655282-2655404, 2655733-2656119 Length = 736 Score = 25.4 bits (53), Expect = 6.2 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +1 Query: 7 STSSDEVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQFNQFIVEEGQG 156 S S VEEKKP K + K + R D K+K K F +++ E G Sbjct: 46 SVESSPVEEKKPKKEPTNVKKRRR---DTEAKPKSKSK-FQEYLEMERGG 91 >03_06_0326 + 33150599-33150907,33151013-33151104,33151961-33152057, 33152585-33152656,33152750-33152812,33152905-33153045, 33153603-33153698,33154120-33154404,33154692-33154851, 33154947-33155089,33155688-33155861,33156386-33156652, 33156737-33156856 Length = 672 Score = 25.4 bits (53), Expect = 6.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 32 KKNPLKVNHVRKLKTGYHWTKIN 100 K P K + ++ TGY W K N Sbjct: 551 KYRPRKPKYFNRVHTGYEWNKYN 573 >03_02_0999 - 13105030-13105434,13105716-13105850,13105933-13106133, 13106374-13106673,13106764-13106964,13107246-13107410, 13107484-13107663,13108171-13108212,13108327-13108404 Length = 568 Score = 25.4 bits (53), Expect = 6.2 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 7 STSSDEVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQ 123 +T+ E +EKK K Q +D ++++ + GK +KK+ Sbjct: 523 ATTEGEKKEKKKKKKSDSQDAED-VAMETEESGKKEKKK 560 >03_02_0998 - 13097675-13098079,13098307-13098441,13098522-13098722, 13099060-13099359,13099449-13099649,13099932-13100096, 13100170-13100349,13100896-13100937,13101040-13101117 Length = 568 Score = 25.4 bits (53), Expect = 6.2 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 7 STSSDEVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQ 123 +T+ E +EKK K Q KD ++++ GK KK+ Sbjct: 523 ATAEGEKKEKKKKKKSDSQDAKD-VAMETEASGKKDKKK 560 >01_01_0090 + 706340-707296,707370-707513,707596-707682,707771-708105, 708462-708702,708783-708857,708932-709017,709451-709523, 709637-709961,710092-711750,711938-713322 Length = 1788 Score = 25.4 bits (53), Expect = 6.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 7 STSSDEVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQ 123 S S +E E+ K K +QK R L +NK K K++ Sbjct: 377 SRSYNECEKVKVQKVSGKQKKNKRTRLGKNKGEKGDKEE 415 >01_01_0089 - 699533-699643,699738-700046,700134-700220,700298-700469, 700547-701373,701487-701559,701993-702078,702153-702227, 702308-702548,702905-703239,703328-703414,703497-703640, 703714-704670 Length = 1167 Score = 25.4 bits (53), Expect = 6.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 7 STSSDEVEEKKPSKGKSRQKVKDRLSLDQNKYGKNKKKQ 123 S S +E E+ K K +QK R L +NK K K++ Sbjct: 377 SRSYNECEKVKVQKVSGKQKKNKRTRLGKNKGEKGDKEE 415 >12_01_0513 + 4059586-4059620,4060155-4060365,4060470-4060724, 4060801-4060865,4061120-4061194,4061440-4061575, 4061661-4061753,4061838-4061983,4062074-4062174, 4062259-4062434,4063823-4063900,4063991-4064199, 4064286-4064378,4064888-4064971,4065405-4065506, 4065591-4065678,4065756-4065809,4065869-4066075, 4066970-4067026,4067171-4067225,4067737-4067813, 4067941-4068007,4068383-4068444,4068541-4068603, 4068702-4068830 Length = 905 Score = 25.0 bits (52), Expect = 8.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 14 LVMKLRKKNPLKVNHVRKLKTGYH 85 L++ +K N +KV+H +K YH Sbjct: 446 LIIDKKKGNIIKVDHYNNVKMSYH 469 >11_02_0027 - 7504076-7504904,7505024-7505219,7505401-7505467 Length = 363 Score = 25.0 bits (52), Expect = 8.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 35 KNPLKVNHVRKLKTGYHWTK 94 KN L HV L TG+HW + Sbjct: 189 KNNLHRLHVLVLNTGHHWNR 208 >08_01_0068 + 471729-472460,472578-472655,473270-473507,474130-474205, 474820-474961,475326-475619,476037-476249 Length = 590 Score = 25.0 bits (52), Expect = 8.2 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 28 EEKKPSKGKSRQKVKDRLSLDQNK 99 E+ K SKGKS+QK + RL D++K Sbjct: 358 EDVKGSKGKSKQK-RRRLGNDRHK 380 >07_03_1188 + 24671022-24672482 Length = 486 Score = 25.0 bits (52), Expect = 8.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 31 EKKPSKGKSRQKVKDRLSLDQNKYGKNKK 117 +KK K K +KVK RL+L + K+K+ Sbjct: 439 DKKYVKAKKEKKVKKRLTLPEKMRLKSKR 467 >02_01_0024 + 159595-159801,159892-160017,160201-160338,160431-160526, 160958-161200,161249-161537,161612-161781,161975-162052, 162156-162227,162345-162449,162555-162647,162737-162829, 163109-163235,163317-163330 Length = 616 Score = 25.0 bits (52), Expect = 8.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 91 QNKYGKNKKKQFNQFIVEEGQGNAEKLQKRAERFAGGACV 210 Q++ K + NQ V E + EKL +R + +GG V Sbjct: 408 QDEVNKRVTQIKNQIEVAEQEYEKEKLNERIAKLSGGVAV 447 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.304 0.122 0.320 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,529,351 Number of Sequences: 37544 Number of extensions: 61396 Number of successful extensions: 168 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 14,793,348 effective HSP length: 54 effective length of database: 12,765,972 effective search space used: 255319440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -