BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J13 (569 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||... 26 4.5 >SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 3971 Score = 25.8 bits (54), Expect = 4.5 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +1 Query: 199 YKTIEMSSKHHSRLDSPQANTQRCSPSYSSYQFFWSASTAGTCSL--KSLVTTLNNMRIS 372 ++T E S K S + + S SYSS S S+ CSL + + T+N +S Sbjct: 26 FQTFEESLKLKSNISHTGSFFANLSQSYSSTSIIHSVSSPVDCSLDVNNQINTINITSVS 85 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,204,899 Number of Sequences: 5004 Number of extensions: 41547 Number of successful extensions: 101 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 242064240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -