BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J11 (387 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 1.3 AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 23 5.1 AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 22 6.8 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 1.3 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -1 Query: 375 KSLCAGFP-SAEVNSFGNSS*PTLLIAAVK*QLVIAAFLASIFHIYSLPASAAM 217 KS AG +A VN GN P L + A L I AFL + +LP ++ + Sbjct: 1239 KSFHAGLSIAASVNPHGNDCPPALKLIACVLLLEITAFLRETYQ--TLPKASRL 1290 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 22.6 bits (46), Expect = 5.1 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 346 RSELIREFLITDPVDS 299 R EL+ + +TDP D+ Sbjct: 90 RKELLARYFVTDPADA 105 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 22.2 bits (45), Expect = 6.8 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 155 VLNWMMFGLNGAEIVFNPSA 214 V WM F N ++ +NP++ Sbjct: 85 VYGWMKFSWNDPKLTWNPAS 104 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 427,372 Number of Sequences: 2352 Number of extensions: 8045 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29929410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -