BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J10 (448 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 155 1e-38 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_6617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) 28 4.0 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 27 5.3 SB_7409| Best HMM Match : DUF963 (HMM E-Value=1.6) 27 5.3 SB_16747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_2504| Best HMM Match : Profilin (HMM E-Value=2.9) 27 7.1 SB_472| Best HMM Match : Cas1p (HMM E-Value=0) 27 7.1 SB_49088| Best HMM Match : 2_5_RNA_ligase (HMM E-Value=3.1) 27 7.1 SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_40803| Best HMM Match : SRCR (HMM E-Value=0.00013) 27 9.3 SB_23787| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_11833| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_8046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_7411| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 155 bits (377), Expect = 1e-38 Identities = 80/148 (54%), Positives = 99/148 (66%) Frame = +2 Query: 2 DINHKHDRKVRRTEVKSQDVXXXXXXXXXXXXXXXTNAKFNQIILRRLFMSRINRPPISL 181 DI KH +K R E SQ+V TNAKFNQI+++RL MSR RPP+SL Sbjct: 111 DIEKKHPKKNYRREPVSQNVYIRLLVKLYRFLSRRTNAKFNQIVMKRLCMSRTKRPPLSL 170 Query: 182 SRLARHMKKPTREGLIAVVVGTVSNDVRLYTVPKMTVAALHVTEKARARILAAGGEILTF 361 +RL R MK + I VVVG++++D R++ VP + + AL +E ARARIL AGGEILTF Sbjct: 171 ARLVRKMKASGHKDKICVVVGSITDDKRIFEVPALKICALRFSETARARILKAGGEILTF 230 Query: 362 DQLALRAPTGRKTVLVQGRRNAREAVRH 445 DQLALRAP G+ TVL+QG R AREA RH Sbjct: 231 DQLALRAPLGQNTVLLQGPRKAREAERH 258 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 28.7 bits (61), Expect = 2.3 Identities = 22/79 (27%), Positives = 35/79 (44%) Frame = +2 Query: 182 SRLARHMKKPTREGLIAVVVGTVSNDVRLYTVPKMTVAALHVTEKARARILAAGGEILTF 361 SRL MK PT++G+ V VS +T A E+ RAR+L G + Sbjct: 92 SRLYEEMKHPTQDGMFVAVNSEVSVTFVGKEKEDVTFAKCAWFER-RARMLKGFGFVTFR 150 Query: 362 DQLALRAPTGRKTVLVQGR 418 D + + +K ++ G+ Sbjct: 151 DPATIESVLAKKPHILDGK 169 >SB_6617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 436 CLTSITATLNQYCLTSSGRTE 374 CLTSIT+T Q CLTS T+ Sbjct: 21 CLTSITSTDPQLCLTSITSTD 41 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 436 CLTSITATLNQYCLTSSGRTE 374 CLTSIT+T Q CLTS T+ Sbjct: 81 CLTSITSTDPQLCLTSITSTD 101 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 436 CLTSITATLNQYCLTSSGRTE 374 CLTSIT+T Q CLT TE Sbjct: 201 CLTSITSTDPQPCLTGINTTE 221 Score = 27.1 bits (57), Expect = 7.1 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 436 CLTSITATLNQYCLTSSGRTE 374 CLTSIT+T Q CLTS T+ Sbjct: 9 CLTSITSTDPQPCLTSITSTD 29 Score = 27.1 bits (57), Expect = 7.1 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 436 CLTSITATLNQYCLTSSGRTE 374 CLTSIT+T Q CLTS T+ Sbjct: 129 CLTSITSTDPQPCLTSIKSTD 149 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 436 CLTSITATLNQYCLTS 389 CLTSIT+T Q CLTS Sbjct: 237 CLTSITSTNPQPCLTS 252 >SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) Length = 1844 Score = 27.9 bits (59), Expect = 4.0 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 256 IGDCANDYSDQ-TLACRLLHVACQTGQRNRRSVDTAHK 146 IG+ +N S+ +LA R++H GQ N SV T HK Sbjct: 657 IGESSNSSSNYASLASRIMHGDDVPGQDNDGSVSTIHK 694 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 103 THECQVQPDHPTEIVYEPYQPTSDFFVPFG 192 T + +P PT+I + ++P++DFF P G Sbjct: 16 TKSYKKEPTKPTQIHTKRWRPSTDFFEPDG 45 >SB_7409| Best HMM Match : DUF963 (HMM E-Value=1.6) Length = 183 Score = 27.5 bits (58), Expect = 5.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 118 VQPDHPTEIVYEPYQPTSDFFVPF 189 + P P+ I+ PYQP+S P+ Sbjct: 121 INPYQPSSIIINPYQPSSTIINPY 144 >SB_16747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +1 Query: 61 VLETIGKTVQILG*THECQVQPDHPTEIVYEPYQPTSDFFVPFG 192 +++T QI T + +P PT+I + ++P++DFF P G Sbjct: 4 MIDTAADQCQIA--TKSYKKEPIKPTQIHTKRWRPSTDFFEPDG 45 >SB_2504| Best HMM Match : Profilin (HMM E-Value=2.9) Length = 191 Score = 27.1 bits (57), Expect = 7.1 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = +2 Query: 110 NAKFNQIILRRLFMSRINRPPISLSRLARHMKKPTREGLIAVVVGTVSNDVRLYTVPKMT 289 N + NQI +RLF IN PP L+ +A T L + G ND L + T Sbjct: 91 NLQRNQITQKRLFNLLIN-PPTQLAGIAASENNKTVRHLGRHLTGHAKNDA-LSSENNKT 148 Query: 290 VAAL--HVTEKARARILAA 340 V L H+T A+ L++ Sbjct: 149 VRHLGRHLTGHAKNDALSS 167 >SB_472| Best HMM Match : Cas1p (HMM E-Value=0) Length = 932 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -1 Query: 280 RNSVKPHIIGDCANDYSDQTLACRLLHVACQTGQRNRRSVDTAHKQS 140 R+ + P + Y + T C + H A + +RN R+ +T H QS Sbjct: 495 RHGLAPRMPASDPYGYHNDTGTCHI-HTAERLARRNPRNTETNHDQS 540 >SB_49088| Best HMM Match : 2_5_RNA_ligase (HMM E-Value=3.1) Length = 410 Score = 27.1 bits (57), Expect = 7.1 Identities = 22/81 (27%), Positives = 35/81 (43%) Frame = +2 Query: 122 NQIILRRLFMSRINRPPISLSRLARHMKKPTREGLIAVVVGTVSNDVRLYTVPKMTVAAL 301 N + R + R+NR P L+ R +K+ ++G+I V V + + V Sbjct: 129 NSVARLRGLLRRLNRQPEVLAEYDRIIKEQLQKGIIEEVANLELEGVNHFFSHREVVTKE 188 Query: 302 HVTEKARARILAAGGEILTFD 364 T K R A+ EI+ FD Sbjct: 189 SETTKVRIVYDASAREIV-FD 208 >SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 90 DTWLDARMPSSTRSSYGDCL*AVSTDLRFLCP 185 D W+D R T +S +C V T R++CP Sbjct: 571 DAWMDLRSCDGTEASVTEC---VGTFDRYICP 599 >SB_40803| Best HMM Match : SRCR (HMM E-Value=0.00013) Length = 269 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 90 DTWLDARMPSSTRSSYGDCL*AVSTDLRFLCP 185 D W+D R T +S +C V T R++CP Sbjct: 191 DAWMDLRSCDGTEASVTEC---VGTFDRYICP 219 >SB_23787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 90 DTWLDARMPSSTRSSYGDCL*AVSTDLRFLCP 185 D W+D R T +S +C V T R++CP Sbjct: 150 DAWMDLRSCDGTEASVTEC---VGTFDRYICP 178 >SB_11833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 636 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/40 (27%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -1 Query: 256 IGDCANDYSDQTLACRLLHVACQTGQRNRRS-VDTAHKQS 140 + ++Y +L C + CQT Q R++ +D H S Sbjct: 178 LASAMHEYCSISLVCAQIRALCQTNQSKRKTDIDHLHASS 217 >SB_8046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = -1 Query: 298 CGYCHFRNSVKPHIIG----DCANDYSDQTLACRLLHVAC-QTGQR 176 C C + S +PH+IG +C DY D T AC TG + Sbjct: 709 CDQCGGQCSCRPHVIGRKCDECRPDYYDFTSGLGCKACACNMTGSK 754 >SB_7411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 221 GLIAVVVGTVSNDVRLYTVPKM 286 G +A++V S VR+YTVPK+ Sbjct: 79 GGLALIVSLYSPSVRIYTVPKI 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,707,691 Number of Sequences: 59808 Number of extensions: 267455 Number of successful extensions: 699 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -