BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J07 (475 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 30 0.013 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 26 0.15 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 3.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 5.8 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 29.9 bits (64), Expect = 0.013 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 5/64 (7%) Frame = +3 Query: 39 YWLIHLFYNIKNFNVMSSFDNAVFNTTLCEVLFLQIEHTLS-----FAKDFFESCFSSLP 203 +W++ L YN+ F S N +F+ + FL + + + K F FS +P Sbjct: 370 FWVMKLLYNVLRFGAESQTINFMFSFGFILLRFLSVFESCTRLNNESRKPSFVIQFSHIP 429 Query: 204 IDNL 215 +DN+ Sbjct: 430 VDNI 433 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 26.2 bits (55), Expect = 0.15 Identities = 6/20 (30%), Positives = 15/20 (75%) Frame = +2 Query: 2 IADYKFAIFIMNVLVNPFIL 61 + DY F ++++ +++NP +L Sbjct: 130 VIDYLFTVYLLPIIINPLVL 149 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.8 bits (44), Expect = 3.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 198 LPIDNLPKSFVPLSELSFYEDIAEVSYFN 284 +P L K +VP+ LS IA +SY N Sbjct: 1 MPQVKLHKHYVPIILLSKILGIAPISYKN 29 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 5.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 48 IHLFYNIKNFNVMS 89 I ++ NIKNFN+ S Sbjct: 569 IGVYRNIKNFNIPS 582 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,821 Number of Sequences: 336 Number of extensions: 2281 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -