BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J07 (475 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0186 + 15243150-15243563,15243685-15243777,15244604-152446... 28 4.4 07_03_0698 - 20765305-20768526 27 7.7 >03_03_0186 + 15243150-15243563,15243685-15243777,15244604-15244666, 15245028-15245114,15245197-15245349,15245422-15245579, 15246458-15246692,15246782-15246892,15246942-15246968, 15247269-15248327,15248432-15248692,15249011-15249196, 15249642-15250793,15250886-15251236,15251343-15251738 Length = 1581 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 Query: 60 YNIKNFNVMSSFDNAVFNTTLCEVLFLQIEHTLSFAKDFFESCFS 194 Y + N S ++ + T+ +++ L++ HTLSF + E C + Sbjct: 181 YLLFMINAFQSLEDELVRETILQLVSLKLWHTLSFGRLQMELCLN 225 >07_03_0698 - 20765305-20768526 Length = 1073 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -1 Query: 436 LSLTCSIVADEAGFISRSEIRLPYTRHEMKINNNVKRNI 320 ++L ++ DEA + R L + EM+ NNV R+I Sbjct: 9 VNLVLGLIQDEARLLGRVREDLQFIMQEMESMNNVLRHI 47 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,923,754 Number of Sequences: 37544 Number of extensions: 189940 Number of successful extensions: 383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -