Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0001_J07
         (475 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ974169-1|ABJ52809.1|  508|Anopheles gambiae serpin 11 protein.       23   4.1  

>DQ974169-1|ABJ52809.1|  508|Anopheles gambiae serpin 11 protein.
          Length = 508

 Score = 23.4 bits (48), Expect = 4.1
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 3/67 (4%)
 Frame = +3

Query: 69  KNFNVMSSFDNAVFNTTLCEVLFLQIEHTLSFAKDFFESCFSSLPID---NLPKSFVPLS 239
           K+F  ++       + T   V+ L I HTL F  D     F+ + ID    LP  F  +S
Sbjct: 440 KSFLTVNPHGTVAASVTTATVIPLSITHTLDFKAD---QPFALIIIDKQNKLPLFFAKIS 496

Query: 240 ELSFYED 260
           + S  +D
Sbjct: 497 KPSKPKD 503


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 463,548
Number of Sequences: 2352
Number of extensions: 9106
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 41670678
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)