BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J07 (475 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72050.2 68414.m08328 zinc finger (C2H2 type) family protein ... 29 1.2 At1g72050.1 68414.m08329 zinc finger (C2H2 type) family protein ... 29 1.2 At3g04880.1 68416.m00530 DNA-damage-repair/toleration protein (D... 28 2.8 At1g33560.1 68414.m04153 disease resistance protein (CC-NBS-LRR ... 27 6.5 >At1g72050.2 68414.m08328 zinc finger (C2H2 type) family protein contains multiple zinc finger domains: PF00096: Zinc finger, C2H2 type Length = 412 Score = 29.5 bits (63), Expect = 1.2 Identities = 22/60 (36%), Positives = 28/60 (46%) Frame = -1 Query: 361 RHEMKINNNVKRNIHVKVFKSKN*NSLK*ETSAISS*KDNSLKGTKDFGKLSIGSDEKQD 182 + E + NV R HVK + S N N K T KDN+ KG D K G EK++ Sbjct: 131 KSEFSVQGNVGR--HVKKYHS-NDNRDKDNTGLGDGDKDNTCKGDDDKEKSGSGGCEKEN 187 >At1g72050.1 68414.m08329 zinc finger (C2H2 type) family protein contains multiple zinc finger domains: PF00096: Zinc finger, C2H2 type Length = 324 Score = 29.5 bits (63), Expect = 1.2 Identities = 22/60 (36%), Positives = 28/60 (46%) Frame = -1 Query: 361 RHEMKINNNVKRNIHVKVFKSKN*NSLK*ETSAISS*KDNSLKGTKDFGKLSIGSDEKQD 182 + E + NV R HVK + S N N K T KDN+ KG D K G EK++ Sbjct: 43 KSEFSVQGNVGR--HVKKYHS-NDNRDKDNTGLGDGDKDNTCKGDDDKEKSGSGGCEKEN 99 >At3g04880.1 68416.m00530 DNA-damage-repair/toleration protein (DRT102) identical to DNA-damage-toleration protein DRT102 SP:Q05212 from [Arabidopsis thaliana]; contains Pfam profile: PF02502 ribose/galactose isomerase Length = 310 Score = 28.3 bits (60), Expect = 2.8 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 271 TSAISS*KDNSLKGTKDFGKLSIGSDEKQDSKKSFANDKVCSI*RNR 131 +S ISS DNSL GK + G + ++ A+ +C + +NR Sbjct: 149 SSVISSFLDNSLSEMSQIGKSTAGDSTTKKIDETTASCVICCLAKNR 195 >At1g33560.1 68414.m04153 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 787 Score = 27.1 bits (57), Expect = 6.5 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +3 Query: 48 IHL-FYNIKNFNVMSSFDNAVFNTTLCEVLFLQIEHTLSFAKDFFESCFSSLPIDNLPK 221 IHL F +KN V +SFD + +L ++ + L F + +SL I N P+ Sbjct: 605 IHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPR 663 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,462,995 Number of Sequences: 28952 Number of extensions: 176642 Number of successful extensions: 392 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 811731120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -