BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J05 (629 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69717-1|CAA93531.1| 1391|Caenorhabditis elegans Hypothetical pr... 29 3.6 AF101305-4|AAR85910.1| 342|Caenorhabditis elegans Serpentine re... 28 6.3 >Z69717-1|CAA93531.1| 1391|Caenorhabditis elegans Hypothetical protein E01G6.1 protein. Length = 1391 Score = 28.7 bits (61), Expect = 3.6 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 3/93 (3%) Frame = +1 Query: 166 CEPLLNLFRNKSRTAEDKKLLGDSQC--GYENNIPMVCCPIS-NACKTPDDKPGICVGLY 336 C+ L+ L K+ +E ++ + C GYE N CCP S NAC + C G Sbjct: 424 CDGLVPL---KNPNSELQRCSEEDPCPAGYECNDSSYCCPSSENACNANMSRGNGCKG-- 478 Query: 337 NCEHITYMMLDKTRKSKMDYVRQSVCNGPETFS 435 + DK++K +V P F+ Sbjct: 479 -STQRSMWFYDKSKKKCSQFVYNGCGGTPNRFT 510 >AF101305-4|AAR85910.1| 342|Caenorhabditis elegans Serpentine receptor, class ab (class a-like) protein 2 protein. Length = 342 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -1 Query: 551 RLHXTRCCFLVGKAVTALEHLSLRVISSGFISGGGPQHTLNVSGPLQTDC 402 RLH C V ++ L H+S+R+I G + LN GP Q C Sbjct: 50 RLHFNSKCIFVTFNISVLVHVSVRIILHG-------KDFLNYVGPWQNGC 92 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,579,941 Number of Sequences: 27780 Number of extensions: 301446 Number of successful extensions: 779 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -