BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J04 (534 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 30 1.4 SB_43991| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 27 9.6 SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) 27 9.6 SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 29.9 bits (64), Expect = 1.4 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +2 Query: 128 GATLTKTHIPGFGDKMTAAGKVNLFHNDNHDFSAKAFATKNLPNIPQ-VPNFNTVGAG 298 G+T T IPG G + GK ++ N H S A P VP T GAG Sbjct: 322 GSTTKTTKIPGPGKIHISTGKPSITDNTKHKTSPSADGKGGKGEEPTIVPEMTTQGAG 379 >SB_43991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 28.7 bits (61), Expect = 3.2 Identities = 21/64 (32%), Positives = 31/64 (48%) Frame = +3 Query: 273 RTSTLSVPEWTTCSRTRLVHLRPPLTPMSLIVMTTLWGEN*ISSRLRPHRWTSTPVGRSS 452 ++ +S P W +RT L+H + L + L+G+ SS L HRW S VG S Sbjct: 1083 QSKLMSTPHWNQSARTSLLH------SVCLRYIEVLFGK---SSSL--HRWGSPKVGESP 1131 Query: 453 IRLS 464 R + Sbjct: 1132 TRFA 1135 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 28.7 bits (61), Expect = 3.2 Identities = 20/59 (33%), Positives = 25/59 (42%) Frame = -3 Query: 502 KRETSAGFPRGLNERRIELLPTGVEVQRCGRSLEEIQFSPQRVVITIKDIGVSGGRRCT 326 K E A P L R L + + CG + IQ S R V T+ VS G +CT Sbjct: 304 KTEIQASHPTALIRRSCICLMRALALT-CGLHADSIQTSQVRTVSTLLHKLVSAGTKCT 361 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 161 FGDKMTAAGKVNLFH---NDNHDFSAKAFATKNLPNIPQVPNFNTV 289 FGDK A + FH ND D S + T+ + ++ +P + TV Sbjct: 587 FGDKWIGANTIRAFHHTDNDGIDASENSNLTRIIFDLSTLPMYETV 632 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 27.1 bits (57), Expect = 9.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 262 SSSSELQHCRCRSGLHVQGQDW 327 SS +LQ C+ +G H+Q +DW Sbjct: 332 SSRVDLQACKLGTGRHLQRRDW 353 >SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) Length = 550 Score = 27.1 bits (57), Expect = 9.6 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 2/83 (2%) Frame = +2 Query: 14 ITGNENHRLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDKMTAAG-- 187 +T E +L ALG +T+ + T L++ N + A+ K+ I G T Sbjct: 408 VTAMEEDQLVALG---VTHVLNAAQGTKRLSHVNTD---ASFYKSGIIFHGIPATDVFMF 461 Query: 188 KVNLFHNDNHDFSAKAFATKNLP 256 K+N + ++ DF A A TKN P Sbjct: 462 KLNKYFDEAADFIASAVGTKNCP 484 >SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +2 Query: 65 TNQMKLGAATAGLAYDNVNGHGAT--LTKTHIPGFGDKMTAAGKVNLFHNDNHDFSAKA 235 TNQ L Y+ +N A L + +P G+K +G+ N+ D DFS A Sbjct: 59 TNQTLLHVVVLDTQYERMNSTYACALLANSRLPCVGEKDCESGEGNISSIDMKDFSNAA 117 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,756,361 Number of Sequences: 59808 Number of extensions: 389085 Number of successful extensions: 946 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 946 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -