BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J02 (505 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC651.08c |rpc1||DNA-directed RNA polymerase III complex large... 27 1.6 SPBC354.03 |swd3||WD repeat protein Swd3|Schizosaccharomyces pom... 26 2.8 SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 26 3.7 SPBC337.03 |||conserved eukaryotic protein|Schizosaccharomyces p... 25 6.5 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 25 6.5 SPAC12B10.05 |||metallopeptidase|Schizosaccharomyces pombe|chr 1... 25 8.5 >SPBC651.08c |rpc1||DNA-directed RNA polymerase III complex large subunit Rpc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1405 Score = 27.1 bits (57), Expect = 1.6 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 3/88 (3%) Frame = +1 Query: 151 SRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYD-- 324 S + +++G + + +GT G + G K S +++ + + + AA + + Sbjct: 1228 SVINQESGKIELFMEGT-GLQAVMNTEGIVGTKTSTNHVMEMKDVLGIEAARYSIISEIG 1286 Query: 325 -NVNGHGATLTKTHIPGFGDKMTAAGKV 405 + HG T+ HI GD MT G+V Sbjct: 1287 YTMAKHGLTVDPRHIMLLGDVMTCKGEV 1314 >SPBC354.03 |swd3||WD repeat protein Swd3|Schizosaccharomyces pombe|chr 2|||Manual Length = 380 Score = 26.2 bits (55), Expect = 2.8 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -2 Query: 480 LRNIWHVFSGECFGT--EIVVVVMEEIYFTGSRHFV 379 + IW V SG+C T E + V + + FT +R ++ Sbjct: 203 MARIWDVLSGQCLKTLVEPINVPLSNLQFTENRKYL 238 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 25.8 bits (54), Expect = 3.7 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +1 Query: 253 SALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDKMTAAGKVNLFHNNN 426 +A SV++ N ++ +A++G +NG GA T F + NL HNNN Sbjct: 1036 TAGASVEIQNNIE--SASSGGDKTQLNGPGADQPVTATITFDKTSPWRNRENLSHNNN 1091 >SPBC337.03 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 387 Score = 25.0 bits (52), Expect = 6.5 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 322 DNVNGHGATLTKTHIPGFGDKMTAAGKVNL 411 +N AT T T GFGDK + AGK N+ Sbjct: 251 ENKESTTATSTLTDA-GFGDKSSTAGKHNV 279 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 25.0 bits (52), Expect = 6.5 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +1 Query: 193 DGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPG 372 D +SGA++ V T + GS+ T+ + T+G + V T+T+T I G Sbjct: 792 DTSSGAVIVVEPTAGTVTETIVSGSIPFTSTIPAQGTTSG-TVEVVEPTAGTVTETIISG 850 >SPAC12B10.05 |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 486 Score = 24.6 bits (51), Expect = 8.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 296 PNFIWLVRSTEPRALSLWFSLPVMGTLTIAPEVPSE 189 PNF +L EP A+ L F G+ + +PS+ Sbjct: 106 PNFYYLTGCLEPNAVLLMFKNGASGSYDCSLYLPSK 141 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,009,365 Number of Sequences: 5004 Number of extensions: 38821 Number of successful extensions: 78 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 200198394 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -