BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J02 (505 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43990.2 68418.m05382 SET domain-containing protein identical... 28 4.1 At5g43990.1 68418.m05383 SET domain-containing protein identical... 28 4.1 At1g76070.1 68414.m08834 expressed protein 27 5.4 At1g55860.1 68414.m06406 ubiquitin-protein ligase 1 (UPL1) nearl... 27 5.4 At5g64360.3 68418.m08085 DNAJ heat shock N-terminal domain-conta... 27 7.2 At5g64360.2 68418.m08084 DNAJ heat shock N-terminal domain-conta... 27 7.2 At5g64360.1 68418.m08083 DNAJ heat shock N-terminal domain-conta... 27 7.2 At3g57030.1 68416.m06348 strictosidine synthase family protein s... 27 7.2 At3g44820.1 68416.m04829 phototropic-responsive NPH3 family prot... 27 7.2 At5g55530.3 68418.m06918 C2 domain-containing protein low simila... 27 9.5 At5g55530.2 68418.m06917 C2 domain-containing protein low simila... 27 9.5 At5g55530.1 68418.m06916 C2 domain-containing protein low simila... 27 9.5 At5g20885.1 68418.m02480 zinc finger (C3HC4-type RING finger) fa... 27 9.5 At3g43430.1 68416.m04597 zinc finger (C3HC4-type RING finger) fa... 27 9.5 >At5g43990.2 68418.m05382 SET domain-containing protein identical to SET domain protein SUVR2 [Arabidopsis thaliana] GI:15290521; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif; identical to cDNA SET domain protein SUVR2 GI:15290520 Length = 740 Score = 27.9 bits (59), Expect = 4.1 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +1 Query: 145 ANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYD 324 +N V +AG +DGT+ + + +HKL+A +++ ++L ++ +G Sbjct: 219 SNGHVEEKAGETVSTADGTTNDISPTTVARFSDHKLAA--TIEEPPALELASSASGEVKI 276 Query: 325 NVNGHGAT-LTKTHIP 369 N++ AT + H+P Sbjct: 277 NLSFAPATGGSNPHLP 292 >At5g43990.1 68418.m05383 SET domain-containing protein identical to SET domain protein SUVR2 [Arabidopsis thaliana] GI:15290521; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif; identical to cDNA SET domain protein SUVR2 GI:15290520 Length = 717 Score = 27.9 bits (59), Expect = 4.1 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +1 Query: 145 ANSRVRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYD 324 +N V +AG +DGT+ + + +HKL+A +++ ++L ++ +G Sbjct: 196 SNGHVEEKAGETVSTADGTTNDISPTTVARFSDHKLAA--TIEEPPALELASSASGEVKI 253 Query: 325 NVNGHGAT-LTKTHIP 369 N++ AT + H+P Sbjct: 254 NLSFAPATGGSNPHLP 269 >At1g76070.1 68414.m08834 expressed protein Length = 272 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 406 NLFHNNNHDFSAKAFATKNMPNIPQVPN 489 +L HNN+H+++A + P +P VPN Sbjct: 40 DLHHNNHHNYTAANKMFFSGPMVPLVPN 67 >At1g55860.1 68414.m06406 ubiquitin-protein ligase 1 (UPL1) nearly identical to ubiquitin-protein ligase 1 [Arabidopsis thaliana] GI:7108521; E3, HECT-domain protein family; similar to GI:7108521, GB:AAF36454 from [Arabidopsis thaliana] Length = 3891 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 92 LKSLVTTSNSMRISRSSGLTRGCAGKRVLSLSTLMVPPV 208 ++ L T S+ ++SRS+G G + RVL + + + P+ Sbjct: 3298 VRELATLSSKQKMSRSTGSMAGASILRVLQVLSSLTSPI 3336 >At5g64360.3 68418.m08085 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226 DnaJ domain Length = 464 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -3 Query: 272 STEPRALSLWFSLPVMGTLTIAPEVPSELIVRAPACRRTLE 150 S +P A S W + P L P+ E ++ CRR + Sbjct: 187 SADPMATSFWTACPYCFVLFEYPKAYEECTLKCQECRRAFQ 227 >At5g64360.2 68418.m08084 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226 DnaJ domain Length = 464 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -3 Query: 272 STEPRALSLWFSLPVMGTLTIAPEVPSELIVRAPACRRTLE 150 S +P A S W + P L P+ E ++ CRR + Sbjct: 187 SADPMATSFWTACPYCFVLFEYPKAYEECTLKCQECRRAFQ 227 >At5g64360.1 68418.m08083 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226 DnaJ domain Length = 422 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -3 Query: 272 STEPRALSLWFSLPVMGTLTIAPEVPSELIVRAPACRRTLE 150 S +P A S W + P L P+ E ++ CRR + Sbjct: 187 SADPMATSFWTACPYCFVLFEYPKAYEECTLKCQECRRAFQ 227 >At3g57030.1 68416.m06348 strictosidine synthase family protein similar to strictosidine synthase [Rauvolfia serpentina][SP|P15324] Length = 374 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 293 NFIWLVRSTEPRALSLWFSLPVMGTLTIAPEVP 195 +F+ +V +T + L LW S P GT + E+P Sbjct: 231 SFVLVVETTTCKILRLWLSGPNAGTHQVFAELP 263 >At3g44820.1 68416.m04829 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 661 Score = 27.1 bits (57), Expect = 7.2 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 265 SVDLTNQMKLGAATAGLAYDNVNGHGATLTKTHIPGFGDKMTAAGKVNLFHNNNHDFS-A 441 SVDL ++ T G+ +++ G + ++PG G + + F+ A Sbjct: 264 SVDLFKRLIKTMETKGIRAESLAGAMMYYARKYLPGLGRWQSGTSDSSKSRRRVVSFNLA 323 Query: 442 KAFATKNMPNIPQVPNFNTV 501 KA + +MP + Q+ T+ Sbjct: 324 KASSPSSMPPLDQIALLETI 343 >At5g55530.3 68418.m06918 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 181 TINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKT 360 TI+S+ TS ++V + ENH +++ S+ + + AT G A + + H AT T Sbjct: 242 TIDSE-TSDSLVT---SDAENHVTNSVTSILKQDSPESSNATNGAASPHASAHSATETPN 297 Query: 361 H 363 H Sbjct: 298 H 298 >At5g55530.2 68418.m06917 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 181 TINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKT 360 TI+S+ TS ++V + ENH +++ S+ + + AT G A + + H AT T Sbjct: 242 TIDSE-TSDSLVT---SDAENHVTNSVTSILKQDSPESSNATNGAASPHASAHSATETPN 297 Query: 361 H 363 H Sbjct: 298 H 298 >At5g55530.1 68418.m06916 C2 domain-containing protein low similarity to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 405 Score = 26.6 bits (56), Expect = 9.5 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 181 TINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTKT 360 TI+S+ TS ++V + ENH +++ S+ + + AT G A + + H AT T Sbjct: 242 TIDSE-TSDSLVT---SDAENHVTNSVTSILKQDSPESSNATNGAASPHASAHSATETPN 297 Query: 361 H 363 H Sbjct: 298 H 298 >At5g20885.1 68418.m02480 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 176 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 501 DSVEVRDLRNIWHVFSGEC 445 D EVR+LRN H+F EC Sbjct: 91 DGDEVRELRNCSHMFHREC 109 >At3g43430.1 68416.m04597 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 167 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 501 DSVEVRDLRNIWHVFSGEC 445 D E+R+LRN HVF +C Sbjct: 92 DEDEIRELRNCTHVFHRDC 110 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,615,389 Number of Sequences: 28952 Number of extensions: 210020 Number of successful extensions: 492 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 898188928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -