BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_J01 (298 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070902-1|AAL48524.1| 873|Drosophila melanogaster RE01946p pro... 27 3.2 AE013599-2867|AAF57570.2| 873|Drosophila melanogaster CG10073-P... 27 3.2 BT022712-1|AAY55128.2| 875|Drosophila melanogaster RE61138p pro... 27 5.6 AE013599-2868|AAF57569.1| 875|Drosophila melanogaster CG10081-P... 27 5.6 AE013599-241|AAF57404.2| 554|Drosophila melanogaster CG9447-PA ... 26 9.7 >AY070902-1|AAL48524.1| 873|Drosophila melanogaster RE01946p protein. Length = 873 Score = 27.5 bits (58), Expect = 3.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 51 YYPTPVILFYLYITTNIYSVTISHYYY 131 Y+ TPV+L LYI ++ +++ Y Y Sbjct: 455 YFSTPVLLIGLYICPSLLGLSLPSYIY 481 >AE013599-2867|AAF57570.2| 873|Drosophila melanogaster CG10073-PA protein. Length = 873 Score = 27.5 bits (58), Expect = 3.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 51 YYPTPVILFYLYITTNIYSVTISHYYY 131 Y+ TPV+L LYI ++ +++ Y Y Sbjct: 455 YFSTPVLLIGLYICPSLLGLSLPSYIY 481 >BT022712-1|AAY55128.2| 875|Drosophila melanogaster RE61138p protein. Length = 875 Score = 26.6 bits (56), Expect = 5.6 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 51 YYPTPVILFYLYITTNIYSVTISHYYY 131 Y+ TP +L LYI ++ +T+ Y Y Sbjct: 455 YFATPSLLIGLYICPSLLGLTLPSYIY 481 >AE013599-2868|AAF57569.1| 875|Drosophila melanogaster CG10081-PA protein. Length = 875 Score = 26.6 bits (56), Expect = 5.6 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 51 YYPTPVILFYLYITTNIYSVTISHYYY 131 Y+ TP +L LYI ++ +T+ Y Y Sbjct: 455 YFATPSLLIGLYICPSLLGLTLPSYIY 481 >AE013599-241|AAF57404.2| 554|Drosophila melanogaster CG9447-PA protein. Length = 554 Score = 25.8 bits (54), Expect = 9.7 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 36 TKL*LYYPTPVILFYLYITTNIYSVTISHYYYKGFIHNMSLLS*YP 173 T L L + P +L Y+ IY + Y Y F H+ + YP Sbjct: 412 TLLALAFAVPAVLTYVLELDGIYHIRPETYRYLYFRHSDTFYQMYP 457 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,269,623 Number of Sequences: 53049 Number of extensions: 171975 Number of successful extensions: 184 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 24,988,368 effective HSP length: 73 effective length of database: 21,115,791 effective search space used: 527894775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -