BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I24 (559 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.15c |qcr1|mas1|mitochondrial processing peptidase comp... 29 0.46 SPBC887.10 |mcs4||two-component response regulator |Schizosaccha... 25 7.5 SPAPB2B4.04c ||pmc1, pmc1|P-type ATPase, calcium transporting Pm... 25 7.5 SPAC23H4.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 10.0 >SPBP23A10.15c |qcr1|mas1|mitochondrial processing peptidase complex beta subunit Qcr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 457 Score = 29.1 bits (62), Expect = 0.46 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +3 Query: 132 PSLQVLSIGESVGPFPTFVGIKLNTGGRRPYKADIYFIVEGMS 260 PS + LS+G G P FVG ++ A+I VEGMS Sbjct: 230 PSAEQLSLGAPRGLKPRFVGSEIRARDDDSPTANIAIAVEGMS 272 >SPBC887.10 |mcs4||two-component response regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 522 Score = 25.0 bits (52), Expect = 7.5 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 6/99 (6%) Frame = +3 Query: 114 QEDAGAPSLQVLSIGESVGPFPTFVGIKLNTGGRRPYKADIYFIVEGMSSSILK------ 275 Q G PS Q+ I VG P V G + P+ + + ++ ++ I++ Sbjct: 318 QAHLGFPSNQIDGI---VGTSPVNVLTSPGIGAKAPFASLLEGVIPPINVLIVEDNIINQ 374 Query: 276 KILQYVWSFHNFQQEKLLAILKGIKSWKIKSPEKVHIDI 392 KIL+ N E L+ ++ WK KS + +DI Sbjct: 375 KILETFMKKRNISSEVAKDGLEALEKWKKKSFHLILMDI 413 >SPAPB2B4.04c ||pmc1, pmc1|P-type ATPase, calcium transporting Pmc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1292 Score = 25.0 bits (52), Expect = 7.5 Identities = 12/54 (22%), Positives = 26/54 (48%) Frame = +3 Query: 117 EDAGAPSLQVLSIGESVGPFPTFVGIKLNTGGRRPYKADIYFIVEGMSSSILKK 278 ++ G ++ + + F +F + +G YK YF+V+GM +L++ Sbjct: 647 KELGLTNVDSMRSSVDIKQFFSFSSDRKASGAIFEYKDKYYFVVKGMPERVLQQ 700 >SPAC23H4.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 24.6 bits (51), Expect = 10.0 Identities = 12/47 (25%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -1 Query: 364 FIFHDFIPF-NIASNFSCWKL*KLHTYCKIFFKILLDMPSTMKYMSA 227 F++H + N +N S + ++ T +F L ++PS +Y+S+ Sbjct: 251 FLYHMLVSLHNQVTNTSHLEKQRISTVATLFISKLFEIPSLSEYLSS 297 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,377,745 Number of Sequences: 5004 Number of extensions: 50688 Number of successful extensions: 130 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -