BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I24 (559 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 23 6.8 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 23 6.8 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 23 6.8 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 23 9.0 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 482 YVCQILPIQTIKSRLIHVSCEYCFVLQF 399 YVC+ + I ++ H CE C + Q+ Sbjct: 248 YVCRESFVDPIVTKCKHYFCERCALAQY 275 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 482 YVCQILPIQTIKSRLIHVSCEYCFVLQF 399 YVC+ + I ++ H CE C + Q+ Sbjct: 248 YVCRESFVDPIVTKCKHYFCERCALAQY 275 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 23.0 bits (47), Expect = 6.8 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 348 LYLLILQAISPV-GNYENSIRTVRSSLKYYSTC 253 L+ LI I P+ G Y + + VR+S+++ C Sbjct: 44 LFYLIFLVIPPLTGGYTDGHQRVRTSVEFLFNC 76 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -1 Query: 178 GNGPTDSPILRTW 140 G PTD P +TW Sbjct: 40 GQNPTDEPQFKTW 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,896 Number of Sequences: 2352 Number of extensions: 12886 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -