BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I22 (575 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.12 |rqh1|hus2, rad12, rec9|RecQ type DNA helicase Rqh1|... 29 0.64 SPAC6F6.02c |pof5||F-box protein Pof5|Schizosaccharomyces pombe|... 27 1.5 SPAC869.10c |||proline specific permease |Schizosaccharomyces po... 26 3.4 SPBP23A10.07 |rpa2||DNA-directed RNA polymerase I complex subuni... 26 4.5 SPAC824.08 |gda1|gdp1|guanosine-diphosphatase Gda1|Schizosacchar... 25 7.9 >SPAC2G11.12 |rqh1|hus2, rad12, rec9|RecQ type DNA helicase Rqh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1328 Score = 28.7 bits (61), Expect = 0.64 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = +1 Query: 184 TTAVSSVKAGHSIDVVISGKTPEDKMAGILLEARQGDKI-VGTWTVSPDDTFSQPLNCGE 360 TT + ++G S DVV+ +D L +A + K V ++ + +PL GE Sbjct: 423 TTDPINDESGASSDVVVIDDEEDDIENRPLNQALKASKAAVSNASLLQSSSLDRPL-LGE 481 Query: 361 PNNAVTHKMHAKELDRQTVSYPWT 432 + HK+ LD +SYPW+ Sbjct: 482 MKDK-NHKVLMPSLDDPMLSYPWS 504 >SPAC6F6.02c |pof5||F-box protein Pof5|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 27.5 bits (58), Expect = 1.5 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +1 Query: 97 PTGAPPSACFDMIPGHAADVQTVPAPYT--ITTAVSSVKAGHSIDVVISGKTP 249 P S F+ IP +V+++ Y+ + T +S +KA + ++ GK P Sbjct: 257 PANYITSTAFESIPESGHNVRSLEITYSGSLLTNISLIKADDLVGALVDGKLP 309 >SPAC869.10c |||proline specific permease |Schizosaccharomyces pombe|chr 1|||Manual Length = 552 Score = 26.2 bits (55), Expect = 3.4 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +1 Query: 496 FWVGIESAPVKVLSH*IMSVIIT 564 F +GI++A + VL+H I +VI+T Sbjct: 321 FVIGIQNAEIPVLNHIINAVILT 343 >SPBP23A10.07 |rpa2||DNA-directed RNA polymerase I complex subunit Rpa2|Schizosaccharomyces pombe|chr 2|||Manual Length = 1227 Score = 25.8 bits (54), Expect = 4.5 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -3 Query: 267 AGHFVFGCFAADNHVNGMTSFYRAD---SCSDGVRRWYCLNISSV 142 AG FG D + TSF D +CSD + W C + S+ Sbjct: 1104 AGGIRFGEMERDAVIGHGTSFLMQDRLMNCSDYAQSWVCRDCGSI 1148 >SPAC824.08 |gda1|gdp1|guanosine-diphosphatase Gda1|Schizosaccharomyces pombe|chr 1|||Manual Length = 556 Score = 25.0 bits (52), Expect = 7.9 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = +1 Query: 316 VSPDDTFSQPLNCGEPNNAVTHKMHAKELDRQTVSYPWTAPKDLEGDVVFKVTI 477 ++P D +PL EP VT + K VS P AP DV F +I Sbjct: 67 LNPKDELEEPLFSEEPLFPVTTSIPTK----TAVSKPKIAPTSAAKDVTFSSSI 116 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,486,314 Number of Sequences: 5004 Number of extensions: 53563 Number of successful extensions: 119 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -