BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I21 (361 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_58205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 27 3.5 SB_24692| Best HMM Match : Disintegrin (HMM E-Value=7.6e-23) 27 4.6 SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) 27 4.6 SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 SB_50529| Best HMM Match : 7TMR-HDED (HMM E-Value=2.3) 27 6.1 SB_11307| Best HMM Match : Pam16 (HMM E-Value=5.4) 27 6.1 SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) 26 8.0 SB_6377| Best HMM Match : Exo_endo_phos (HMM E-Value=6.5e-10) 26 8.0 SB_5763| Best HMM Match : Cadherin (HMM E-Value=0) 26 8.0 >SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.7 bits (61), Expect = 1.5 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = +3 Query: 57 SASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL*LETKI 236 SA+TA S+ + TL +S ++GPTP + ++ L+ + + L + + + Sbjct: 113 SATTAQDSSVLDTLATLATATLSHNTGPTPSTSMQQATSLAGRISVTPLTLSQNTISSSL 172 Query: 237 TG-SVPLAP 260 +G S PL P Sbjct: 173 SGLSTPLTP 181 >SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 27.9 bits (59), Expect = 2.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 75 TCSLKSLVTTLNNMRISRSSGPTPGC 152 T + K+++TTL MRI ++GP C Sbjct: 654 TTTKKTIITTLTTMRICAANGPLIDC 679 >SB_58205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 3.5 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 148 GAPASGCTNCQLRRHLRCYGQGTYNWKRKS 237 G PA N QL R RC TY W RKS Sbjct: 73 GKPAYFAKNLQLDRK-RCLYPKTYTWDRKS 101 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 27.5 bits (58), Expect = 3.5 Identities = 22/87 (25%), Positives = 37/87 (42%) Frame = +2 Query: 68 SRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGNENHRLS 247 +R + EP ++ EDQ E A+S +R +AG +D G + + T N NH Sbjct: 1183 ARKAQINEPPSPLKVQEDQRETEAHSPIRTRAGREATCNDHLKGCVNQA--TCN-NHLKG 1239 Query: 248 ALGSVDLTNQMKLGAATAGLAYDNVNG 328 + + +K G D++ G Sbjct: 1240 CVNQATCNDHLK-GCVNQATCNDHLKG 1265 >SB_24692| Best HMM Match : Disintegrin (HMM E-Value=7.6e-23) Length = 1592 Score = 27.1 bits (57), Expect = 4.6 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 169 TNCQLRRHL-RCYGQGTYNWKRKSQAQCPWLRRS 267 TN Q L R Y YNW+ + + PWL ++ Sbjct: 1207 TNIQTNVSLVRKYNSWEYNWRNSLEKRMPWLGKT 1240 >SB_58553| Best HMM Match : rve (HMM E-Value=0.0011) Length = 1745 Score = 27.1 bits (57), Expect = 4.6 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +3 Query: 39 SYQFFWSASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL 218 S+ FW +S+ + S S+ +L+++R S G + LS T P W+R++ Sbjct: 376 SHSGFWFSSSRFSRSSSSISDSLSSLRSRASWRRLTDVLGSSMVSLSVATTPCSSWARFV 435 >SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 26.6 bits (56), Expect = 6.1 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 80 LVEEPGYYIEQYEDQPEQW 136 L EEPGYYIE + PE W Sbjct: 210 LDEEPGYYIE--KKAPESW 226 >SB_50529| Best HMM Match : 7TMR-HDED (HMM E-Value=2.3) Length = 697 Score = 26.6 bits (56), Expect = 6.1 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +3 Query: 51 FWSASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL 218 FW +S+ + S S+ +L+++R S G + LS T P W+RY+ Sbjct: 262 FWFSSSRFSRSSSSISDSLSSLRSRASWRRLSDVLGSSMVSLSGATTPCSSWTRYV 317 >SB_11307| Best HMM Match : Pam16 (HMM E-Value=5.4) Length = 405 Score = 26.6 bits (56), Expect = 6.1 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +3 Query: 51 FWSASTAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKRVH*LSTQTAPQVLWSRYL 218 FW +S+ + S S+ +L+++R S G + LS T P W+RY+ Sbjct: 69 FWFSSSRFSRSSSSISDSLSSLRSRASWRRLSDVLGSSMVSLSGATTPCSSWTRYV 124 >SB_18269| Best HMM Match : CUB (HMM E-Value=7.4e-37) Length = 1655 Score = 26.2 bits (55), Expect = 8.0 Identities = 17/62 (27%), Positives = 31/62 (50%) Frame = +2 Query: 11 HTKMFAKLFLVSVLLVGVNSRYVLVEEPGYYIEQYEDQPEQWANSRVRRQAGALTVNSDG 190 H+ + L L L+ GV + +++ Y E ++ E W + R+ + AGAL++ S Sbjct: 1039 HSYLLTNLALADFLM-GVYMLLIAIKDVEYQGEYFKHDIE-WRSGRLCQFAGALSLTSSE 1096 Query: 191 TS 196 S Sbjct: 1097 VS 1098 >SB_6377| Best HMM Match : Exo_endo_phos (HMM E-Value=6.5e-10) Length = 450 Score = 26.2 bits (55), Expect = 8.0 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +1 Query: 166 CTNCQLRRHLRCYGQGTYNWKRKSQAQCPWL 258 C C + H+RC T + + + C W+ Sbjct: 116 CDFCDIWSHIRCLNMNTIIYDALANSSCVWV 146 >SB_5763| Best HMM Match : Cadherin (HMM E-Value=0) Length = 674 Score = 26.2 bits (55), Expect = 8.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 20 MFAKLFLVSVLLVGVNSRYVLVEEPGYYIEQYEDQPE 130 + + L V V + VN + PGY IE +E+ PE Sbjct: 210 LVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPE 246 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,607,450 Number of Sequences: 59808 Number of extensions: 222458 Number of successful extensions: 601 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 572951758 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -