BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I20 (514 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32) 30 0.97 SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) 28 3.9 SB_14968| Best HMM Match : IL3 (HMM E-Value=8.6) 28 5.2 SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) 28 5.2 SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) 28 5.2 SB_24208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) 27 6.9 SB_25108| Best HMM Match : Cornifin (HMM E-Value=0.00015) 27 9.1 SB_20022| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.1e-20) 27 9.1 >SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32) Length = 1556 Score = 30.3 bits (65), Expect = 0.97 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 2/82 (2%) Frame = +1 Query: 157 NLFHNNDHDLSAKAFAT-RNMPTISHLPST-NTVGGGLEYMFKDKIGASASAAHTDFFNK 330 NL +D+++ T ++M + PST N GL+ + GAS S D F++ Sbjct: 513 NLTFKKAYDIASSMETTAQHMADLQSAPSTLNVELNGLKVQMELDTGASLSVIGEDIFDQ 572 Query: 331 NDYXLGGKLNLFKTPSTSLDFT 396 G LNL T T +T Sbjct: 573 LKNIEGSSLNLQDTKLTLKTYT 594 >SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) Length = 808 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +1 Query: 121 GIGDKLSVAGKVNLFHNNDHDLSAKAFAT 207 G+ D L++ G VN+FHN DL++++ +T Sbjct: 612 GLSD-LTIDGHVNIFHNQGTDLNSQSGST 639 >SB_14968| Best HMM Match : IL3 (HMM E-Value=8.6) Length = 321 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/59 (23%), Positives = 25/59 (42%) Frame = +1 Query: 163 FHNNDHDLSAKAFATRNMPTISHLPSTNTVGGGLEYMFKDKIGASASAAHTDFFNKNDY 339 F N D++ + H P N GGG+ +FKD + ++ + FN ++ Sbjct: 224 FKNGDYNSAEMGTLCPTGYRFLHSPRLNARGGGVALLFKDLLRLEINSRICEHFNTFEF 282 >SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) Length = 2658 Score = 27.9 bits (59), Expect = 5.2 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Frame = +1 Query: 229 HLPSTNTVGGGLEYMFKDKIGASASAAHTDFFNKNDYXLGGKLNLFKTPST-----SLDF 393 HLP+ ++ +F D + A + FNK D + L L + + SL F Sbjct: 107 HLPTAGDKEAAIDAIFYDDLMLGLCAMVSWVFNKEDTLIITTLRLSWSNNASGTGQSLPF 166 Query: 394 TAGWHKFDTP 423 TA W+ F P Sbjct: 167 TAKWYMFRHP 176 >SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1706 Score = 27.9 bits (59), Expect = 5.2 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = +2 Query: 158 TCFITTTMIYPRRRSRPEICPPFPIYHQPTLLVVVSNICSRTRSVHQRAP 307 TC T Y R R C PF + T V SN C TR+ + P Sbjct: 26 TCRFETC--YERDTGRATPCMPFTSFMSLTRNVTTSNTCGTTRAKYCELP 73 >SB_24208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 27.5 bits (58), Expect = 6.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 232 NGKWWAYFWSRTPSRINH 179 N +WW Y + RTP H Sbjct: 13 NSEWWMYLYHRTPEGATH 30 >SB_17069| Best HMM Match : Transposase_8 (HMM E-Value=7.7) Length = 733 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 244 WLMVNGKWWAYFWSRTPSRINHG 176 WL+ N W FW+ P +HG Sbjct: 165 WLLSNTNWMRKFWTSDPKFRSHG 187 >SB_25108| Best HMM Match : Cornifin (HMM E-Value=0.00015) Length = 858 Score = 27.1 bits (57), Expect = 9.1 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -1 Query: 286 SCP*TYIRDHHQQCWLMVNG 227 SCP + +R H + CW++ +G Sbjct: 395 SCPGSALRRHKEDCWVIFSG 414 >SB_20022| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.1e-20) Length = 392 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -1 Query: 220 WAYFWSRTPSRINHGRCYETGSLYQQQTIYLQFQEYEC 107 W YF+ TP+R G L + YL F+ Y C Sbjct: 227 WPYFYW-TPNRCPKGEPVCKSELNSKYKFYLAFENYNC 263 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,578,868 Number of Sequences: 59808 Number of extensions: 357003 Number of successful extensions: 812 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -