BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I20 (514 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81523-6|CAB04244.1| 2586|Caenorhabditis elegans Hypothetical pr... 29 2.0 Z82267-3|CAB05191.1| 186|Caenorhabditis elegans Hypothetical pr... 27 6.0 >Z81523-6|CAB04244.1| 2586|Caenorhabditis elegans Hypothetical protein F32H2.5 protein. Length = 2586 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 10 LGSVDLTNQIKLGAATAGLVYDNVNRHGATLTNTHIPGIGD 132 +G VDL+ LG A + DNV+ HG L + P +GD Sbjct: 1832 IGKVDLSQNSSLGMAK---LLDNVSVHGILLDSIMDPTVGD 1869 >Z82267-3|CAB05191.1| 186|Caenorhabditis elegans Hypothetical protein F38C2.5 protein. Length = 186 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 217 PTISHLPSTNTVGGGLEYMFKDKIGASASAAHTDF 321 P + S GL F D GASAS++ TDF Sbjct: 151 PLMPQFSSWFAPSSGLSREFLDNFGASASSSSTDF 185 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,212,559 Number of Sequences: 27780 Number of extensions: 265067 Number of successful extensions: 634 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 985905834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -