BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I10 (606 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharom... 27 1.6 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 25 6.5 >SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 693 Score = 27.5 bits (58), Expect = 1.6 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +1 Query: 301 HVTCNQLLTDDISVAATCAKKIYKRHKFDAWYGWKNHCQHGLPDISDC*EKALNFIKQLL 480 HV N + V A+K Y +H ++W + + LP +SD E N+ ++++ Sbjct: 136 HVHKNDINRFGTKVYEELARK-YPQHSLESWRQHYKYMKKRLPPVSDSDES--NYCQRII 192 Query: 481 MKFTSSSCNF 510 +K SS ++ Sbjct: 193 VKPYSSQKDY 202 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 25.4 bits (53), Expect = 6.5 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -2 Query: 548 SIMHNILINIFVLKLQLELVNFIRSCFMKFKAFSQQSLISGS 423 S++ +IL+ +L LQL++ F+ F ++FS+ + S Sbjct: 480 SVVRDILVEDELLNLQLKIRKFLMFTFHIIRSFSELTKFQSS 521 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,492,760 Number of Sequences: 5004 Number of extensions: 49002 Number of successful extensions: 127 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -