BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I10 (606 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47160.1 68415.m05889 anion exchange family protein contains ... 29 3.2 At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase fa... 29 3.2 At2g32010.1 68415.m03911 endonuclease/exonuclease/phosphatase fa... 28 4.2 At3g62270.1 68416.m06996 anion exchange family protein contains ... 27 7.3 At1g68710.1 68414.m07850 haloacid dehalogenase-like hydrolase fa... 27 9.6 >At2g47160.1 68415.m05889 anion exchange family protein contains some similarity to SWISS-PROT:P04919 anion transport protein (anion exchange protein 1) [Mouse] {Mus musculus} Length = 704 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -3 Query: 178 RSRQGRP-SYSSNFHRSLV--F*APALIRIW*NVSHRNAKRVPKG 53 RSR+ R Y + + RSL+ + P ++ +W VS+ A VPKG Sbjct: 217 RSRKARSWRYGTGWLRSLIADYGVPLMVLVWTGVSYIPAGDVPKG 261 >At1g05470.1 68414.m00556 endonuclease/exonuclease/phosphatase family protein simlar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 585 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +1 Query: 148 MSNWVCLVENESGRFTDKIGKVNKNGSRDYGLFQINDKYWCSTGSTPGKDCH 303 M NW L+EN+ R K G V K + F KY ++ G D H Sbjct: 451 MQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSRNSDRYSGDDLH 502 >At2g32010.1 68415.m03911 endonuclease/exonuclease/phosphatase family protein similar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 594 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +1 Query: 148 MSNWVCLVENESGRFTDKIGKVNKNGSRDYGLFQINDKYWCSTGSTPGKDCH 303 M NW L+EN+ R K G V K + F KY ++ G D H Sbjct: 460 MQNWRALLENDQLRIEQKRGHVFKGWNEGKIYFPPTYKYSNNSDRYAGGDLH 511 >At3g62270.1 68416.m06996 anion exchange family protein contains similarity to anion exchanger 3, cardiac splice form - Rattus norvegicus, PIR:A42497 Length = 703 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = -3 Query: 178 RSRQGRP-SYSSNFHRSLV--F*APALIRIW*NVSHRNAKRVPKG 53 RSR+ R Y + + RSLV + P ++ +W VS+ VPKG Sbjct: 217 RSRKARSWRYGTGWLRSLVADYGVPLMVLVWTGVSYIPTGDVPKG 261 >At1g68710.1 68414.m07850 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from {Mus musculus} SP|P98200, {Bos taurus} SP|Q29449, {Homo sapiens} SP|O43520; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1200 Score = 27.1 bits (57), Expect = 9.6 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 12/72 (16%) Frame = -1 Query: 522 HFCFK-ITTGTCKFH*K--------LLYEI*SLFSTVA--NIW-QSMLTVIFPSVPSVKL 379 H+C++ I+T C F K LYE + FS+ N W S+ V F S+P + L Sbjct: 918 HWCYRRISTMICYFFYKNITFGFTLFLYETYTTFSSTPAYNDWFLSLYNVFFSSLPVIAL 977 Query: 378 VAFVNLLCARSC 343 F + AR C Sbjct: 978 GVFDQDVSARYC 989 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,882,425 Number of Sequences: 28952 Number of extensions: 251988 Number of successful extensions: 607 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -