BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I07 (568 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 23 6.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.9 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.0 bits (47), Expect = 6.9 Identities = 10/41 (24%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 48 YCNSASIDTISSDIQFKNVD-RTIDISSQLVKITSKITFEN 167 + +S ++ ++ ++ N D TID L+++ S++TF + Sbjct: 101 HASSGTVVNVARIVEHPNYDDSTIDYDYALLELESELTFSD 141 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 6.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 241 VMNAKFSFAESSTAIRKFFIVD 176 ++NA AE STA+RK F+ D Sbjct: 884 LLNAFVLDAEFSTALRKGFLAD 905 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,535 Number of Sequences: 2352 Number of extensions: 9447 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -