BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I04 (445 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 27 0.23 EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. 22 8.5 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 27.5 bits (58), Expect = 0.23 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 187 EIDRGVRTLEEVQLSVQGVIVTIDEVRV 104 EI +++ E+ +V G IV ID++RV Sbjct: 1630 EIRHNIQSFREILSNVSGCIVNIDDIRV 1657 >EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. Length = 421 Score = 22.2 bits (45), Expect = 8.5 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +2 Query: 107 TDFINRNDYSLDGKLNLFKSPDTSVDFNAGFKKFDTPFMKSSWEPNFG 250 + F++R+D+ + +F+ D++V F+ K + + EP G Sbjct: 36 SSFVSRSDFDWNLAREVFRHEDSNVVFSPFSIKLLLTLLYEAAEPGSG 83 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 370,244 Number of Sequences: 2352 Number of extensions: 7050 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -