BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_I03 (626 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 1.6 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 4.8 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 6.4 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 8.4 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +1 Query: 58 VDQNCYTLITAPENYTISIYFMNVNPNYWNDNYYLDIY 171 VD +T P+ I F NP YW + +++ + Sbjct: 572 VDAPLKDTVTVPDGGFTIIRFKATNPGYWLFHCHIEFH 609 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -3 Query: 594 ARKVSWFLGTKRRLYIAYSVN*LHIILLTVNSHIE 490 +R + LGT+ R ++ ++ L + T+N H+E Sbjct: 439 SRAMDVVLGTEVREFVVNYIDDLLVASETLNEHLE 473 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 580 LVSRNKTTPLHCLLCQLIAHNSAHS*LPYRTSRILRVTV 464 LVS+++ + ++ +CQL + A + T R+TV Sbjct: 72 LVSKSRKSRMNFFICQLAIADLAVGLISVSTDIAWRITV 110 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +1 Query: 82 ITAPENYTISIYFMNVNPNYW 144 I P N + F NP YW Sbjct: 647 IAVPNNGYVIFRFRADNPGYW 667 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,871 Number of Sequences: 336 Number of extensions: 2967 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -