BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H23 (542 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54280.1 68414.m06188 haloacid dehalogenase-like hydrolase fa... 27 8.1 >At1g54280.1 68414.m06188 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|O43520], Mus musculus [SP|P70704]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1240 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 165 WAIRVLTVLCTIGYLIPIFNNPVSAFYKALLANAATSALRLH 290 W + ++T L GYLIPI K L A+ L+L+ Sbjct: 357 WVVHLITALLLYGYLIPISLYVSIEVVKVLQAHFINQDLQLY 398 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,967,048 Number of Sequences: 28952 Number of extensions: 244209 Number of successful extensions: 612 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -