BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I09A02NGRL0001_H23
(542 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At1g54280.1 68414.m06188 haloacid dehalogenase-like hydrolase fa... 27 8.1
>At1g54280.1 68414.m06188 haloacid dehalogenase-like hydrolase
family protein similar to Potential
phospholipid-transporting ATPase (EC 3.6.3.1) from Homo
sapiens [SP|O43520], Mus musculus [SP|P70704]; contains
InterPro accession IPR005834: Haloacid dehalogenase-like
hydrolase
Length = 1240
Score = 27.1 bits (57), Expect = 8.1
Identities = 14/42 (33%), Positives = 20/42 (47%)
Frame = +3
Query: 165 WAIRVLTVLCTIGYLIPIFNNPVSAFYKALLANAATSALRLH 290
W + ++T L GYLIPI K L A+ L+L+
Sbjct: 357 WVVHLITALLLYGYLIPISLYVSIEVVKVLQAHFINQDLQLY 398
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,967,048
Number of Sequences: 28952
Number of extensions: 244209
Number of successful extensions: 612
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 604
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 612
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1013649368
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -