BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H22 (354 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0086 - 14729240-14729494,14730107-14730307 31 0.26 04_01_0175 - 1972361-1972429,1973185-1973334,1974956-1975105,197... 27 4.2 >10_08_0086 - 14729240-14729494,14730107-14730307 Length = 151 Score = 31.1 bits (67), Expect = 0.26 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -2 Query: 152 GMSAKHVPSLIGCKHSGGGSLTLQI 78 G+ AK VP+L+ C H GGG + +++ Sbjct: 121 GVGAKGVPTLVACCHRGGGEVGVRL 145 >04_01_0175 - 1972361-1972429,1973185-1973334,1974956-1975105, 1975370-1975417,1975717-1975793,1975897-1975999, 1977103-1977233,1978793-1978970,1980656-1980676, 1981233-1981290,1981381-1981444,1982261-1982431, 1982526-1982637,1982779-1983021,1983783-1983964, 1984785-1984920 Length = 630 Score = 27.1 bits (57), Expect = 4.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 64 IVHSVICSVKEPPPECLQPINEGTCLADIPSYGY 165 I+ S++ + KEP P+ P +A+ P+YG+ Sbjct: 250 IIFSLLPACKEPDPDTGIPFKVDAIIANPPAYGH 283 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,860,072 Number of Sequences: 37544 Number of extensions: 141826 Number of successful extensions: 296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 296 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 530315984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -