BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H21 (513 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11260.1 68418.m01315 bZIP protein HY5 (HY5) identical to HY5... 34 0.065 At4g35040.1 68417.m04972 bZIP transcription factor family protei... 32 0.26 At4g30790.1 68417.m04362 expressed protein 31 0.60 At2g14340.1 68415.m01604 hypothetical protein 31 0.60 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 29 1.4 At2g16770.1 68415.m01923 expressed protein 29 1.4 At1g18460.1 68414.m02303 lipase family protein similar to triacy... 28 3.2 At5g49150.1 68418.m06083 hypothetical protein 28 4.2 At5g65930.2 68418.m08300 kinesin-like calmodulin-binding protein... 27 5.6 At5g65930.1 68418.m08299 kinesin-like calmodulin-binding protein... 27 5.6 At4g24220.1 68417.m03476 expressed protein protein induced upon ... 27 5.6 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 27 5.6 At4g21450.2 68417.m03102 vesicle-associated membrane family prot... 27 7.4 At4g21450.1 68417.m03103 vesicle-associated membrane family prot... 27 7.4 At4g01230.1 68417.m00162 reticulon family protein (RTNLB7) weak ... 27 7.4 At1g07560.1 68414.m00809 leucine-rich repeat protein kinase, put... 27 7.4 At5g55310.1 68418.m06893 DNA topoisomerase I, putative similar t... 27 9.8 At4g12050.1 68417.m01917 DNA-binding protein-related contains Pf... 27 9.8 At3g54620.1 68416.m06043 bZIP transcription factor family protei... 27 9.8 At2g46180.1 68415.m05742 intracellular protein transport protein... 27 9.8 At1g50710.1 68414.m05702 expressed protein 27 9.8 >At5g11260.1 68418.m01315 bZIP protein HY5 (HY5) identical to HY5 protein GI:2251085 from [Arabidopsis thaliana] Length = 168 Score = 33.9 bits (74), Expect = 0.065 Identities = 16/54 (29%), Positives = 34/54 (62%) Frame = +1 Query: 145 QNKNAATRYRQKKKAEVEVLLNEEQALRKHHSELGDKCSDLQREIRYIKGLMRD 306 +N+ +A + R++KKA + L N + L +SEL ++ S LQ E + ++ ++++ Sbjct: 97 RNRVSAQQARERKKAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKN 150 >At4g35040.1 68417.m04972 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 261 Score = 31.9 bits (69), Expect = 0.26 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = +1 Query: 148 NKNAATRYRQKKKAEVEVLLNEEQALRKHHSELGDKCSD---LQREIRYIKGLMRDL 309 N+ A +YR+KKKA+ L +E LR + +L + + L+ E+ +K L+ DL Sbjct: 99 NREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDL 155 >At4g30790.1 68417.m04362 expressed protein Length = 1148 Score = 30.7 bits (66), Expect = 0.60 Identities = 19/69 (27%), Positives = 38/69 (55%) Frame = +1 Query: 193 VEVLLNEEQALRKHHSELGDKCSDLQREIRYIKGLMRDLFKAKGLIK*IHSVNRLQR*KV 372 + VL ++ L KH EL +KC +L+ + +DL + K L+K +++ ++L + + Sbjct: 951 IRVLADKVSFLSKHREELLEKCQNLEATSEQTR---KDLEEKKELVKTLYTKHQLGK-QA 1006 Query: 373 SKPRICVAR 399 +K +I R Sbjct: 1007 NKEKISFGR 1015 >At2g14340.1 68415.m01604 hypothetical protein Length = 220 Score = 30.7 bits (66), Expect = 0.60 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 208 NEEQALRKHHSELGDKCSDLQREIRYIKGLMRD 306 N+ QA R+HH +L K DL+R +R ++ +D Sbjct: 120 NQHQAYRRHHRQLLIKLQDLERGMRRLEAHPKD 152 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 229 YAGPVPR*EGPRPQPFSFGGSGWLHFYSAPFYENDG 122 Y+ P P G P +GG G+ +Y P+Y N G Sbjct: 67 YSPPPPSSSGGVKYPPPYGGDGYGGYYPPPYYGNYG 102 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 Query: 220 PVPR*EGPRPQPFSFGGSGWLHFYSAP 140 PVP P P P S G G ++YS P Sbjct: 44 PVPSSYSPPPPPPSSSGGGGSYYYSPP 70 >At2g16770.1 68415.m01923 expressed protein Length = 249 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Frame = +1 Query: 148 NKNAATRYRQKKKAEVEVLLNEEQALRKHHSELGDKC---SDLQREIRYIKGLMRDL 309 N+ A +YR+KKKA+ L +E L+ +++L + + L+ E+ +K L+ D+ Sbjct: 84 NREAVRKYREKKKAKAASLEDEVMRLKAVNNQLLKRLQGQAALEAEVTRLKCLLVDI 140 >At1g18460.1 68414.m02303 lipase family protein similar to triacylglycerol lipase, gastric precursor (EC 3.1.1.3) {Canis familiaris} [SP|P80035] Length = 701 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 2/24 (8%) Frame = -2 Query: 353 RLTLWI--YLIRPLALKRSRMRPL 288 R+ LW+ YL+R LA + SRM+PL Sbjct: 147 RILLWVPLYLLRLLARRNSRMQPL 170 >At5g49150.1 68418.m06083 hypothetical protein Length = 896 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -3 Query: 199 PRPQPF-SFGGSGWLHFYSAPFYENDGHRRTVNMVLGETVPTIPHRWRRTAV 47 P QP + G+G H + P YE G R + N+V ++ + + +RT + Sbjct: 280 PTIQPREALNGTGSSHQAATPLYEKHGGRASGNLVTQASIFDVTYTPKRTGI 331 >At5g65930.2 68418.m08300 kinesin-like calmodulin-binding protein (ZWICHEL) identical to kinesin-like protein GI:2224925 from [Arabidopsis thaliana] Length = 1260 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 136 KKEQNKNAATRYRQKKKAEVEVLLNEEQALRKHH 237 +K + A + + + AE+E+L EEQ LRK + Sbjct: 845 RKNEQTAAILKMQGAQLAELEILYKEEQVLRKRY 878 >At5g65930.1 68418.m08299 kinesin-like calmodulin-binding protein (ZWICHEL) identical to kinesin-like protein GI:2224925 from [Arabidopsis thaliana] Length = 1259 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 136 KKEQNKNAATRYRQKKKAEVEVLLNEEQALRKHH 237 +K + A + + + AE+E+L EEQ LRK + Sbjct: 844 RKNEQTAAILKMQGAQLAELEILYKEEQVLRKRY 877 >At4g24220.1 68417.m03476 expressed protein protein induced upon wounding - Arabidopsis thaliana, PID:e257749 Length = 388 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 262 RSICLQVPSDVYAGPVPR*EGPRPQP 185 R +CLQ + Y GP +GPR P Sbjct: 138 RHVCLQTGTKHYLGPFTNVDGPRHDP 163 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = +1 Query: 136 KKEQNK----NAATRYRQKKKAEVEVLLNEEQALRKHHSELGDKCSDLQRE 276 +KEQ++ + ++ K+ AE+ + +++QAL + E+ K S LQ+E Sbjct: 658 RKEQDEKDLLDRMAQFEDKRMAELSDINHQKQALNREMEEMMSKRSALQKE 708 >At4g21450.2 68417.m03102 vesicle-associated membrane family protein / VAMP family protein similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia] Length = 212 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 190 QPFSFGGSGWLHFYSAPFYENDGHRRTVNMVLGETVPT 77 +P S G GW F+ PF + GHR + P+ Sbjct: 7 KPTSDGKGGW-GFFKIPFRNSSGHRNAASSAATSPFPS 43 >At4g21450.1 68417.m03103 vesicle-associated membrane family protein / VAMP family protein similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia] Length = 295 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 190 QPFSFGGSGWLHFYSAPFYENDGHRRTVNMVLGETVPT 77 +P S G GW F+ PF + GHR + P+ Sbjct: 7 KPTSDGKGGW-GFFKIPFRNSSGHRNAASSAATSPFPS 43 >At4g01230.1 68417.m00162 reticulon family protein (RTNLB7) weak similarity to SP|O95197 Reticulon protein 3 (Neuroendocrine-specific protein-like) {Homo sapiens}; contains Pfam profile PF02453: Reticulon Length = 242 Score = 27.1 bits (57), Expect = 7.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 148 SAPFYENDGHRRTVNMVLGETVPTIPHRWRRTAVMTAVMNAV 23 +AP Y G R ++MVLG + WR V +++AV Sbjct: 48 NAPIYRMFGRERPIHMVLGGAADVL--LWRDKKVTLGLLSAV 87 >At1g07560.1 68414.m00809 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 856 Score = 27.1 bits (57), Expect = 7.4 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -2 Query: 377 FDTFYRWRRLTLWIYLIRPLALKRSRMRPLMYRISRC 267 +D+ W+ L L + + P +LKR M +++ + C Sbjct: 788 YDSGSAWKALELAMTCVNPSSLKRPNMSHVVHELKEC 824 >At5g55310.1 68418.m06893 DNA topoisomerase I, putative similar to Swiss-Prot:P30181 DNA topoisomerase I [Arabidopsis thaliana] Length = 917 Score = 26.6 bits (56), Expect = 9.8 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 169 YRQKKKAEVEVLLNEEQALRKHHSELGDKCSDLQREIR-YIKGLMRDLFKAK 321 Y+Q K EV ++ N ++ + K H +K + E+R IK L DL +AK Sbjct: 762 YQQANK-EVAIICNHQRTVSKSHGAQVEKLAVKIEELREQIKELNIDLDRAK 812 >At4g12050.1 68417.m01917 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 339 Score = 26.6 bits (56), Expect = 9.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 172 RQKKKAEVEVLLNEEQALRKHHSELGDKC 258 + K KA + + + ALR H E+GD C Sbjct: 128 KNKPKAPIIITRDSANALRTHVMEIGDGC 156 >At3g54620.1 68416.m06043 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 403 Score = 26.6 bits (56), Expect = 9.8 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 148 NKNAATRYRQKKKAEVEVLLNEEQALRKHHSELGDKCSDLQRE 276 N+ +A R R++K+ ++ + LR HS L ++ SD+ + Sbjct: 239 NRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHK 281 >At2g46180.1 68415.m05742 intracellular protein transport protein USO1-related similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 725 Score = 26.6 bits (56), Expect = 9.8 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +1 Query: 136 KKEQNKNAATRYRQKKKAEVEVLLNEEQALRKHHSELGDKCSDLQREIRYIKGLMRDL 309 K +++ RQ + + +L E+ALR+ + + S EIR KG++ DL Sbjct: 391 KMDEDSRLIDELRQTNEYQRSQILGLEKALRQTMANQEEIKSSSDLEIRKSKGIIEDL 448 >At1g50710.1 68414.m05702 expressed protein Length = 423 Score = 26.6 bits (56), Expect = 9.8 Identities = 18/72 (25%), Positives = 35/72 (48%) Frame = +1 Query: 148 NKNAATRYRQKKKAEVEVLLNEEQALRKHHSELGDKCSDLQREIRYIKGLMRDLFKAKGL 327 N+N++ R ++ K +E + +E ALR+ K ++ + I G++ L K L Sbjct: 252 NRNSSARLPERVKFIIEEIERDEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKL 311 Query: 328 IK*IHSVNRLQR 363 + H N +Q+ Sbjct: 312 -EHQHKYNEMQK 322 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,691,144 Number of Sequences: 28952 Number of extensions: 182478 Number of successful extensions: 649 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -