BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H18 (528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 24 0.95 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 2.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.7 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.9 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 23.8 bits (49), Expect = 0.95 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 119 CSTGSTPGKDCHVTCNQLLTDDISVAATCAKKI 217 C G T GK CH N + TC KI Sbjct: 56 CQPGFT-GKYCHENINDCKVNPCENGGTCVDKI 87 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 2.2 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -2 Query: 410 FLNISIMHNILINIFVLNYNW 348 ++N + +LIN++ +NYN+ Sbjct: 109 YVNKAKFGKLLINLYTINYNF 129 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.7 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 83 DYGLFQINDKYWCSTGSTPGK 145 DY + YW G+ PGK Sbjct: 2538 DYFNANFSLNYWIEKGADPGK 2558 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 20.6 bits (41), Expect = 8.9 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 16 PCRERKRTVYRQNW 57 PCR R++ +R+N+ Sbjct: 589 PCRPREQLTWRRNF 602 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 20.6 bits (41), Expect = 8.9 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 16 PCRERKRTVYRQNW 57 PCR R++ +R+N+ Sbjct: 481 PCRPREQLTWRRNF 494 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,036 Number of Sequences: 336 Number of extensions: 2594 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -