BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H17 (348 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 1.2 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 22 2.1 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 2.1 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 20 8.3 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 20 8.3 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.6 bits (46), Expect = 1.2 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -2 Query: 329 ELVRIDNQPGVAERTQLLQHRP 264 EL+ +D++PG+ +R + H P Sbjct: 340 ELLPLDSEPGMLKRKRQKYHDP 361 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.8 bits (44), Expect = 2.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 341 GATAELVRIDNQPGVAERTQLLQHRPEP*VDVCPDTG 231 G +++R Q +AER + L++ P +DVC + G Sbjct: 43 GNLFDIMRTPEQLFLAERERGLKYYPIYKLDVCGNGG 79 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 2.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 292 SATPGWLSIRTSSAVAPPP 348 +ATP S TS A APPP Sbjct: 18 AATPISSSGMTSPAAAPPP 36 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 19.8 bits (39), Expect = 8.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 18 LYDHQHVVAEPLN 56 +Y HQ VA P N Sbjct: 10 MYRHQQAVAAPAN 22 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 19.8 bits (39), Expect = 8.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 18 LYDHQHVVAEPLN 56 +Y HQ VA P N Sbjct: 10 MYRHQQAVAAPAN 22 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,088 Number of Sequences: 336 Number of extensions: 1744 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -