BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H11 (227 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53537| Best HMM Match : Neur_chan_LBD (HMM E-Value=0) 26 4.2 SB_49939| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.3 >SB_53537| Best HMM Match : Neur_chan_LBD (HMM E-Value=0) Length = 379 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 176 KLYLLGGHYFIHLH*RNIHLVISFNAKIIQYIS 78 KL+ + YFI+ N H V NA+II Y S Sbjct: 121 KLFWIPDTYFINAKKSNFHKVTKENARIIIYPS 153 >SB_49939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 25.4 bits (53), Expect = 7.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 25 SLNISNQYLPTNSMYLNLDIY 87 S +IS QYLPT+ M+ N+ Y Sbjct: 169 SRSISFQYLPTDDMFYNMYQY 189 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,553,043 Number of Sequences: 59808 Number of extensions: 46916 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 16,821,457 effective HSP length: 53 effective length of database: 13,651,633 effective search space used: 300335926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -