BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H07 (596 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 29 0.086 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 29 0.15 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 28 0.20 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 28 0.26 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 27 0.46 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 27 0.46 EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. 26 0.80 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 26 1.1 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 26 1.1 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 26 1.1 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 26 1.1 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 1.4 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 25 2.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 3.2 AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse t... 24 4.3 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 4.3 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 24 4.3 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 5.7 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 5.7 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 5.7 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 5.7 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 5.7 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 5.7 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 5.7 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 5.7 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 5.7 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 5.7 Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. 23 7.5 Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. 23 7.5 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 7.5 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 9.9 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 9.9 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 29.5 bits (63), Expect = 0.086 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 CY C +RGH ARDC Sbjct: 390 CYRCLERGHLARDC 403 Score = 25.8 bits (54), Expect = 1.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 516 CYDCGDRGHYARDCS 560 C CG GHYA+ C+ Sbjct: 413 CIRCGADGHYAKSCT 427 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 28.7 bits (61), Expect = 0.15 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 516 CYDCGDRGHYARDCS 560 C CG GH ARDCS Sbjct: 500 CIRCGSEGHKARDCS 514 Score = 24.2 bits (50), Expect = 3.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 CY C +RGH A C Sbjct: 477 CYRCLERGHLAHAC 490 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 28.3 bits (60), Expect = 0.20 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 CY C +RGH +RDC Sbjct: 406 CYRCLERGHVSRDC 419 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 27.9 bits (59), Expect = 0.26 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 CY C +RGH AR+C Sbjct: 364 CYRCLERGHIAREC 377 Score = 25.8 bits (54), Expect = 1.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 516 CYDCGDRGHYARDCS 560 C CG GH A+DC+ Sbjct: 387 CIRCGAEGHLAKDCN 401 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 27.1 bits (57), Expect = 0.46 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 CY C + GH ARDC Sbjct: 551 CYRCLEHGHNARDC 564 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 27.1 bits (57), Expect = 0.46 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 C+ C + GH++RDC Sbjct: 418 CFKCWETGHFSRDC 431 >EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. Length = 152 Score = 26.2 bits (55), Expect = 0.80 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 120 FMHFFIYKVTWSLCI*TCG 176 F HFF +T +LC+ CG Sbjct: 1 FFHFFTEMITQNLCVCPCG 19 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + HH HH + T++ HG +L HH Sbjct: 199 IAHHAAPIAHHAAPIAHSTSSIVHGPSHLSHH 230 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -3 Query: 546 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 H+ + HH + HH+ V A A H + H Sbjct: 32 HSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQH 66 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + HH HH + T++ HG +L HH Sbjct: 201 IAHHAAPIAHHAAPIAHSTSSIVHGPSHLSHH 232 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + HH HH + T++ HG +L HH Sbjct: 199 IAHHAAPIAHHAAPIAHSTSSIVHGPSHLSHH 230 Score = 22.6 bits (46), Expect = 9.9 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -3 Query: 546 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 H+ + HH + HH+ V A A H + H Sbjct: 32 HSTIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQH 66 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.8 bits (54), Expect = 1.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 CY C + GH+A DC Sbjct: 662 CYRCLELGHWAHDC 675 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 25.4 bits (53), Expect = 1.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 C+ CG GH RDC Sbjct: 76 CFFCGQPGHKKRDC 89 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 24.6 bits (51), Expect = 2.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 C+ C +RGH R+C Sbjct: 236 CFRCLERGHMVREC 249 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.2 bits (50), Expect = 3.2 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 C++C +GH AR+C Sbjct: 377 CFNCLRKGHSAREC 390 >AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse transcriptase protein. Length = 131 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 534 CHHNHSSGHHMDVVVAE-TAAEDHGRHNLV 448 CH +SG MDV+ + AA D H L+ Sbjct: 55 CHAAFASGAQMDVIYTDLKAAFDRVNHRLL 84 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.8 bits (49), Expect = 4.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 516 CYDCGDRGHYARDCS 560 C+ C +RGH DC+ Sbjct: 291 CFRCLERGHTTADCA 305 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 23.8 bits (49), Expect = 4.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 C CG GH R+C Sbjct: 352 CIKCGQEGHKIREC 365 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -3 Query: 546 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLV 448 H+ H +H HH A A H +HN++ Sbjct: 496 HSHHAHPHHHHHHHHHHPTAADLAGYHHQHNVI 528 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 206 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 237 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 206 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 237 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -3 Query: 546 HNALCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 H+++ HH + HH+ V A A H + H Sbjct: 32 HSSIQHHAAPAIHHVGSVHAAPAIYQHSAPAIYQH 66 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 230 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 261 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 198 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 206 IAHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 237 >Z22930-6|CAA80518.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 495 VVAETAAEDHGRHNLVH 445 VVA A+ GRH+LVH Sbjct: 16 VVACAQAQPSGRHHLVH 32 >Z18890-1|CAA79328.1| 277|Anopheles gambiae trypsin protein. Length = 277 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 495 VVAETAAEDHGRHNLVH 445 VVA A+ GRH+LVH Sbjct: 16 VVACAQAQPSGRHHLVH 32 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 537 LCHHNHSSGHHMDVVVAETAAEDHGRHNLVHH 442 + H+ HH + T++ HG +L HH Sbjct: 198 ITHYAAPIAHHAAPIAHSTSSIVHGPSHLSHH 229 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 516 CYDCGDRGHYARDC 557 C CG GH AR C Sbjct: 531 CIRCGLTGHKARSC 544 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +1 Query: 439 LMVDEVMAAVVLRRGLGYHHVHMMTAAMIV 528 L + +AA + + LG+HH H+ + +V Sbjct: 268 LQSEAQLAAALKLKTLGHHHHHLPPSTALV 297 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,402 Number of Sequences: 2352 Number of extensions: 11597 Number of successful extensions: 70 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -