BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H05 (493 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.5 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 3.5 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.0 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 8.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 449 NEQLLSIITYYCPEFDAALPASDCDWSPGPTT 354 N ++ I+T P ++ W+PG TT Sbjct: 1333 NVNVVDIVTTAKPAQSTTSVSTTTSWNPGSTT 1364 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.8 bits (44), Expect = 3.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 27 PRPPHCPFFGGNARALLEFRR 89 P PP PF+ G + L ++R Sbjct: 205 PFPPPYPFYPGTSAMLAAYQR 225 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 20.6 bits (41), Expect = 8.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 207 PLTEPLVEPLTEPLVE 254 PLT P EPL P E Sbjct: 105 PLTPPNSEPLVSPKSE 120 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 20.6 bits (41), Expect = 8.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -3 Query: 413 PEFDAALPASDCDWSPGPTTII 348 P+F L +C+WS GP + Sbjct: 10 PQFGLQL---ECNWSSGPNATL 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,851 Number of Sequences: 336 Number of extensions: 1322 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11525470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -