BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H04 (387 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30630| Best HMM Match : Hydrolase (HMM E-Value=2.5e-05) 28 3.1 SB_7994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_29511| Best HMM Match : CHGN (HMM E-Value=0.00037) 26 9.3 >SB_30630| Best HMM Match : Hydrolase (HMM E-Value=2.5e-05) Length = 839 Score = 27.9 bits (59), Expect = 3.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 292 QEAYAYKMNVNFLASGANNVGVGSAGSGIYS 384 Q++++ VN LA+ N +G GSGIYS Sbjct: 533 QQSWSRVTCVNLLAANQNQPALGMWGSGIYS 563 >SB_7994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 27.1 bits (57), Expect = 5.3 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -2 Query: 359 PTPTLLAPEARKFTFILYAYASWIXHSQSRYGNSGRNPQWV 237 P L+A +T +Y Y S QSRY G + WV Sbjct: 277 PVAHLVATTGEDYTVRVYDYLSKKQMCQSRYSTGGTSLLWV 317 >SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 298 AYAYKMNVNFLASGANNVGVGSAGSGIYS 384 ++A + VNFLA+ + + GSGIYS Sbjct: 1092 SWARGIGVNFLAANTHVPSFANTGSGIYS 1120 >SB_29511| Best HMM Match : CHGN (HMM E-Value=0.00037) Length = 955 Score = 26.2 bits (55), Expect = 9.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 241 HCGFLPELPYLDW 279 HCGF P +PY W Sbjct: 825 HCGFTPSIPYGFW 837 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,739,343 Number of Sequences: 59808 Number of extensions: 247015 Number of successful extensions: 533 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 669365910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -