BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H04 (387 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor... 27 0.32 AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor... 27 0.32 AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor... 27 0.32 AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor... 27 0.32 AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor... 27 0.32 AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor... 27 0.32 AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor... 27 0.32 AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor... 27 0.32 AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor... 27 0.32 AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor... 27 0.32 AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor... 27 0.32 AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor... 27 0.32 AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor... 27 0.32 AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor... 27 0.32 AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825656-1|AAV70219.1| 152|Anopheles gambiae olfactory receptor... 27 0.32 AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor... 27 0.32 AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor... 27 0.32 AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor... 27 0.32 AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor... 27 0.32 AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor... 27 0.32 AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor... 27 0.32 AY825684-1|AAV70247.1| 166|Anopheles gambiae olfactory receptor... 25 0.73 AY825683-1|AAV70246.1| 166|Anopheles gambiae olfactory receptor... 25 0.73 AY825680-1|AAV70243.1| 158|Anopheles gambiae olfactory receptor... 25 0.73 AY825679-1|AAV70242.1| 158|Anopheles gambiae olfactory receptor... 25 0.73 AY825678-1|AAV70241.1| 167|Anopheles gambiae olfactory receptor... 25 0.73 AY825677-1|AAV70240.1| 167|Anopheles gambiae olfactory receptor... 25 0.73 AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor... 25 0.73 AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor... 25 0.73 AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor... 25 0.73 AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor... 25 0.73 AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor... 25 0.73 AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor... 25 0.97 AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor... 25 0.97 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 24 2.2 AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor... 23 3.9 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 3.9 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 5.1 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 22 6.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 22 6.8 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 22 6.8 >AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 78 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 107 >AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 78 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 107 >AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 78 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 107 >AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 77 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 106 >AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 77 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 106 >AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825656-1|AAV70219.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 69 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 98 >AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 80 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 109 >AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 83 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 112 >AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 83 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 112 >AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 81 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 110 >AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 75 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 104 >AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 26.6 bits (56), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW I VN L G Sbjct: 75 FLYELPYYDWSTTIGYVVNMMFQVNLLVIG 104 >AY825684-1|AAV70247.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 80 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 109 >AY825683-1|AAV70246.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 80 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 109 >AY825680-1|AAV70243.1| 158|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 158 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 72 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 101 >AY825679-1|AAV70242.1| 158|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 158 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 72 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 101 >AY825678-1|AAV70241.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 80 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 109 >AY825677-1|AAV70240.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 80 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 109 >AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 81 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 110 >AY825672-1|AAV70235.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 80 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 109 >AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL +LPY DW I VN L G Sbjct: 78 FLYQLPYYDWSTTIGYVVNMMFQVNLLVIG 107 >AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 80 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 109 >AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 25.4 bits (53), Expect = 0.73 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELPY DW + VN L G Sbjct: 80 FLYELPYYDWSTTMGYVVNMMFQVNLLVIG 109 >AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 25.0 bits (52), Expect = 0.97 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELP+ DW I VN L G Sbjct: 69 FLYELPFYDWSTTIGYVVNMMFQVNLLVIG 98 >AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 25.0 bits (52), Expect = 0.97 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELP+ DW I VN L G Sbjct: 81 FLYELPFYDWSTTIGYVVNMMFQVNLLVIG 110 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.8 bits (49), Expect = 2.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 175 SKCLPSKCPENEGHXXC 225 S+C+ +CP+NE + C Sbjct: 19 SRCVHRRCPKNEVYSCC 35 >AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 23.0 bits (47), Expect = 3.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 250 FLPELPYLDWLCXIQEAYAYKMNVNFLASG 339 FL ELP DW I VN L G Sbjct: 81 FLYELPCYDWSTTIGYVVNMMFQVNLLVIG 110 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.0 bits (47), Expect = 3.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 316 NVNFLASGANNVGVGSAGSG 375 NVN+ +G NN +G G G Sbjct: 180 NVNYSNTGFNNSHMGGGGGG 199 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.6 bits (46), Expect = 5.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 366 CRSDTNVIGPRSQKVHV 316 C + TNVI SQ +H+ Sbjct: 906 CEAPTNVIAVHSQTLHI 922 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 22.2 bits (45), Expect = 6.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 253 LPELPYLDWLCXIQEAYAY 309 +PE DWLC ++ +Y Sbjct: 37 VPEEQIADWLCIAEQGASY 55 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.2 bits (45), Expect = 6.8 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 48 YRKINLFGEYAHTPAYDGL 104 Y + + +G+ ++TP Y+GL Sbjct: 2156 YLETDSYGQDSYTPIYEGL 2174 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.2 bits (45), Expect = 6.8 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 48 YRKINLFGEYAHTPAYDGL 104 Y + + +G+ ++TP Y+GL Sbjct: 2166 YLETDSYGQDSYTPIYEGL 2184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 426,858 Number of Sequences: 2352 Number of extensions: 7077 Number of successful extensions: 59 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29929410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -