BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H03 (628 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038621-4|AAK71387.2| 1064|Caenorhabditis elegans Hypothetical ... 30 1.6 AJ277649-1|CAB90211.1| 917|Caenorhabditis elegans CHE-14 protei... 29 3.6 AF067618-5|AAC19198.2| 917|Caenorhabditis elegans Abnormal chem... 29 3.6 Z70750-3|CAA94738.1| 374|Caenorhabditis elegans Hypothetical pr... 28 6.3 AF039044-8|AAG24129.1| 717|Caenorhabditis elegans Nuclear hormo... 27 8.3 >AF038621-4|AAK71387.2| 1064|Caenorhabditis elegans Hypothetical protein M116.5 protein. Length = 1064 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 411 VIYCLILNRLINIFHSKSQMECSQFEITNRIHPTN 515 +I+ +ILN +++ + +E SQ E TN H TN Sbjct: 133 LIWTIILNFQVSVIRQRLLLESSQHEQTNEKHTTN 167 >AJ277649-1|CAB90211.1| 917|Caenorhabditis elegans CHE-14 protein protein. Length = 917 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -1 Query: 274 SITSFIYIIILTVTLQNT*RTVQHCEKTNII 182 + ++F Y+ +L++TL N +CEKTN++ Sbjct: 881 TFSTFFYLPMLSLTLPNQSGICPYCEKTNLM 911 >AF067618-5|AAC19198.2| 917|Caenorhabditis elegans Abnormal chemotaxis protein 14 protein. Length = 917 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -1 Query: 274 SITSFIYIIILTVTLQNT*RTVQHCEKTNII 182 + ++F Y+ +L++TL N +CEKTN++ Sbjct: 881 TFSTFFYLPMLSLTLPNQSGICPYCEKTNLM 911 >Z70750-3|CAA94738.1| 374|Caenorhabditis elegans Hypothetical protein C50F4.3 protein. Length = 374 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -3 Query: 191 KYNLKAVPLKKVVLEIPKTFDL*N 120 K+NLK + +K+ + +PKTFDL N Sbjct: 125 KFNLKNLRVKRQMEGLPKTFDLRN 148 >AF039044-8|AAG24129.1| 717|Caenorhabditis elegans Nuclear hormone receptor familyprotein 83 protein. Length = 717 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +3 Query: 354 QPKN*LYCSIIT*MPPSSIVIYCLILNRLINIFHSKSQMECS-QFE 488 +P+ L+CS+ P IV ++++ +NIF + S + S QFE Sbjct: 471 RPELILFCSLDRASPSRMIVDVSYLIDKAVNIFETPSYLPSSCQFE 516 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,364,686 Number of Sequences: 27780 Number of extensions: 251373 Number of successful extensions: 527 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -