BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H03 (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.3 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.4 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 477 SQFEITNRIHPTNRKGVHSWTRSPSKI 557 + F++ N+ H R G HSW K+ Sbjct: 689 THFQV-NQSHGIKRSGSHSWEGDSFKV 714 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +1 Query: 466 KWNVVSSKLQTVSTQPTVKASILGLGLPQRSEENCHNCQ 582 K++V + + + QP K S G+ + E+ H C+ Sbjct: 426 KYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCR 464 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,602 Number of Sequences: 438 Number of extensions: 3299 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -