BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_H02 (571 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. 23 5.3 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 9.3 >AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. Length = 226 Score = 23.4 bits (48), Expect = 5.3 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +3 Query: 210 VWVARNPPGFAFVEFEDPRDAEDSVRGLDGTRCCGTRIRVE 332 +W A PPG E+ D E DGT C GTR+ V+ Sbjct: 171 IWKACLPPG----EYCDIISGER-----DGTMCTGTRVLVD 202 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 22.6 bits (46), Expect = 9.3 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 203 YVTIFRKYFFYFILGRVCSKISNVYFTREIPLAVSGHH 90 Y+ + FY LG + K N++ TR VS H Sbjct: 350 YIATDGQEVFYAKLGYIFCKAINIFGTRSTRNTVSKKH 387 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 516,352 Number of Sequences: 2352 Number of extensions: 9012 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -