BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_G15 (586 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 1.6 SB_8875| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_17034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) 29 2.1 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 29 2.8 SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_39205| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.5e-09) 29 3.7 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 28 6.4 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 27 8.5 SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) 27 8.5 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.9 bits (64), Expect = 1.6 Identities = 25/63 (39%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -3 Query: 395 LPAAVT-LSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAK 219 LPAAV + P V+ TP L ATP VA LVK+K P L I K Sbjct: 256 LPAAVPPIKTKPAAPSPVKATPTVAPLVKATPMVAP-----LVKAKLPQPLRILYICEEK 310 Query: 218 GTL 210 GT+ Sbjct: 311 GTV 313 >SB_8875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 327 RPRSKSHGYTHPRVRRQGDSC 389 RP S+SHG HPRV D+C Sbjct: 92 RPTSQSHGNRHPRVPIDKDNC 112 >SB_17034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 230 LPAKGTLTPA-PEVPSELSVRAPCASLRTLELVNSSGSS 117 L AKG L+ P E +RAPC+SL E SSG S Sbjct: 13 LEAKGRLSERRPSAKCESILRAPCSSLEDKESDESSGLS 51 >SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) Length = 646 Score = 29.5 bits (63), Expect = 2.1 Identities = 24/95 (25%), Positives = 45/95 (47%) Frame = +1 Query: 133 LTSSRVRRDAHGALTLNSDGTSGAGVKVPFAGNDKNIVSAIGSLDLTNRQKLGAATAGVA 312 L R +DA + D T ++ F N + V G ++ R + + T ++ Sbjct: 398 LGDPRYMKDADKVVKKMVDQTHSNNLR-KFIDNRTHPVKYYGPINY--RTDVTSGTTHLS 454 Query: 313 LDNVNGHGVSLTDTHIPGFGDKVTAAGKVNLFHND 417 + + +G+GVSLT + FG K+ + K+ + +ND Sbjct: 455 VVDADGNGVSLTSSINKYFGSKIRSK-KLGIIYND 488 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 367 FGDKVTAAGKVNLFH---NDYHDITAKAFATRNMPDIANVPNFNTV 495 FGDK A + FH ND D + + TR + D++ +P + TV Sbjct: 587 FGDKWIGANTIRAFHHTDNDGIDASENSNLTRIIFDLSTLPMYETV 632 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 330 PRSKSHGYTHPRVRRQGDSC 389 P + SH YTH VR GD+C Sbjct: 260 PHALSHNYTHLAVRYYGDAC 279 >SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 330 PRSKSHGYTHPRVRRQGDSC 389 P + SH YTH VR GD+C Sbjct: 260 PHALSHNYTHLAVRYYGDAC 279 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 29.1 bits (62), Expect = 2.8 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -3 Query: 395 LPAAVTL-SPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAK 219 LP V+L S PG TP P +L+S TP+ + L K+ P++L+ S P Sbjct: 1042 LPVPVSLTSKTPGPVSLTSKTPGPVSLTSKTPSPVS----LTSKTPGPVSLSSKTSGPVS 1097 Query: 218 GT-LTPAP 198 T TP P Sbjct: 1098 LTSKTPGP 1105 >SB_39205| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.5e-09) Length = 1084 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 321 CKRPRSKSHGYTHPRVRRQGDSCRQS--ESLPQRLPRHHSEGFRHQK 455 C P K+ HP R+ GD+C E + + LP H E R K Sbjct: 361 CSEPCPKTLECGHPCARKCGDTCTSKCIEKIEKTLPCGHKETVRCYK 407 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 27.9 bits (59), Expect = 6.4 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +3 Query: 342 SHGYTHPRVRRQGDSCRQSESLPQRLPRHHSEGFRHQKYARYR*CTQLQHC 494 +H T+PR R Q D C LP+ P + +A Y C +L HC Sbjct: 1039 AHYLTYPR-RDQRDHCALPR-LPKTRPLRTTSLTPEATFAHYLTCPRLDHC 1087 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -2 Query: 498 TDSVEVGYISDIWHISGGESLRCDVVVIVVEEIHFAGSCHLVSE 367 TD V + +D++ S G L D V + +++H G HL S+ Sbjct: 493 TDDVHLTS-NDVYLTSDGVHLTSDDVHLTGDDVHLTGDVHLTSD 535 >SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1432 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 8/56 (14%) Frame = +3 Query: 327 RPRSKSHGYTHPRVRRQGDSCRQSESLPQR--------LPRHHSEGFRHQKYARYR 470 R R + HG HPR + +S+ L R LPR + + +R + + R R Sbjct: 1323 RDRDRYHGSEHPRSHERSSDYSRSKDLHPRSYDRGTDHLPRSYEKSYRREDHHRSR 1378 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,032,563 Number of Sequences: 59808 Number of extensions: 408117 Number of successful extensions: 1157 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1154 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -