BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_G15 (586 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g13980.1 68414.m01647 pattern formation protein (EMB30) (GNOM... 29 2.3 At3g27925.1 68416.m03484 DegP protease, putative SP:022609; almo... 29 3.0 At2g23300.1 68415.m02781 leucine-rich repeat transmembrane prote... 28 4.0 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 28 5.3 At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 28 5.3 At5g18550.1 68418.m02193 zinc finger (CCCH-type) family protein ... 27 7.0 At1g71320.1 68414.m08232 S locus F-box-related / SLF-related con... 27 7.0 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 27 7.0 At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containi... 27 9.2 At5g22750.1 68418.m02657 SNF2 domain-containing protein / helica... 27 9.2 At1g59820.1 68414.m06735 haloacid dehalogenase-like hydrolase fa... 27 9.2 >At1g13980.1 68414.m01647 pattern formation protein (EMB30) (GNOM) identical to SP|Q42510; contains Pfam profile PF01369: Sec7 domain Length = 1451 Score = 29.1 bits (62), Expect = 2.3 Identities = 22/63 (34%), Positives = 32/63 (50%) Frame = +1 Query: 61 GVQSRYLIVSEPVYYIQHYEEPELLTSSRVRRDAHGALTLNSDGTSGAGVKVPFAGNDKN 240 GV S Y IVS+PV E ++ S + A GA +L DG G G + P + D + Sbjct: 249 GVDSDYAIVSKPVEDGNANSEYDVENS--MATFATGAQSLMDDGPVGPGSRKPASPYDLH 306 Query: 241 IVS 249 I++ Sbjct: 307 IMT 309 >At3g27925.1 68416.m03484 DegP protease, putative SP:022609; almost identical to DegP protease precursor GB:AF028842 from [Arabidopsis thaliana] (J. Biol. Chem. 273 (12), 7094-7098 (1998)) Length = 439 Score = 28.7 bits (61), Expect = 3.0 Identities = 23/80 (28%), Positives = 40/80 (50%) Frame = -3 Query: 359 MCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAKGTLTPAPEVPSEL 180 +C SV L+ F+L +A+PAV + S +V + + + ++ TP+ + L Sbjct: 83 LCTSVALS---FSLFAASPAVESAS-AFVVSTPKKLQTDELATVRLFQENTPSVVYITNL 138 Query: 179 SVRAPCASLRTLELVNSSGS 120 +VR +L LE+ SGS Sbjct: 139 AVRQDAFTLDVLEVPQGSGS 158 >At2g23300.1 68415.m02781 leucine-rich repeat transmembrane protein kinase, putative Length = 773 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 386 AVTLSPNPGMCVSVRLTPWPFTLSSAT--PAVAAPSFCLLVKS 264 +++ S NPG+C P P S AT P + P+ + KS Sbjct: 268 SISFSGNPGLCGGPTRNPCPIPSSPATVSPPTSTPALAAIPKS 310 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 324 KRPRSKSHGYTHPRVRRQGDSCRQSESLPQRLPRHHSEGF 443 + PR +SHG ++ +GD +SE + RH+ + F Sbjct: 253 RSPRGRSHGRSYREDSYEGDHWNESERRREYEDRHNQDHF 292 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = -3 Query: 395 LPAAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSK 261 L A+ LS G+C LTP+ T + A+ P L+K + Sbjct: 1804 LQASQALSRLTGLCADESLTPYNATAADVLKALLTPKLASLLKDE 1848 >At5g18550.1 68418.m02193 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 456 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -3 Query: 389 AAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSK--EPIALT 243 ++++ SP+P + + P+P +L + P+ ++ L+ S EPI T Sbjct: 366 SSLSYSPSPSSLTDMPVAPYPSSLGTLAPSSSSDQCTELISSSSIEPITTT 416 >At1g71320.1 68414.m08232 S locus F-box-related / SLF-related contains F-box domain Pfam:PF00646; contains TIGRFAM TIGR01640: F-box protein interaction domain; similar to S locus F-box (SLF)-S2-like protein (GI:13161528) [Antirrhinum hispanicum] Length = 392 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 359 MCVSVRLTPWPFTLSSATPAVA 294 M +S WPFTLS TPA+A Sbjct: 144 MKLSPEFMQWPFTLSYLTPAMA 165 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 398 TLPAAVTLSPNPGMCVSVRLTPWPFTLSSATPAVAAPS 285 +LP + N + S LTP FT ++A PA P+ Sbjct: 342 SLPPGQYMPGNAALSASTPLTPGQFTTANAPPAPPGPA 379 >At5g65160.1 68418.m08195 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 593 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 265 DLTNRQKLGAATAGVALDNVNGHGVSLT 348 +L N + G TAGV N NG+GV T Sbjct: 180 NLGNLNQTGPVTAGVNYGNNNGYGVKRT 207 >At5g22750.1 68418.m02657 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to SP|P36607 DNA repair protein rad8 {Schizosaccharomyces pombe}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1029 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = -2 Query: 507 YSATDSVEVGYISDIWHISGGESLRCDVVVIVVEEIHFAGSCHLVSEPGDVCIRETYSVA 328 +S DS E+G I + W RC + ++ ++I GSC E + SV+ Sbjct: 172 FSTKDSGEIGRIPNEW-------ARCLLPLVRDKKIRIEGSCKSAPEALSIMDTILLSVS 224 Query: 327 VYI 319 VYI Sbjct: 225 VYI 227 >At1g59820.1 68414.m06735 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Mus musculus [SP|P70704], {Bos taurus} SP|Q29449; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1213 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 445 ATRNMPDIANVPNFNTVGGGIDYMFKDKIG 534 A N P A N N G ++Y+F DK G Sbjct: 387 AETNTPASARTSNLNEELGQVEYIFSDKTG 416 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,963,068 Number of Sequences: 28952 Number of extensions: 273661 Number of successful extensions: 805 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -