BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_G14 (530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_45417| Best HMM Match : Homeobox (HMM E-Value=5.1e-09) 27 9.5 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 31.5 bits (68), Expect = 0.44 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +2 Query: 77 RRSCKSP-PPCNRCSNNIEPRFSSSIHXXXXXXXXXXXXXXXFTSTQTDSHLSASRLPP 250 R+S KSP PP NR + P+ SSS H F+S+Q + S SR P Sbjct: 153 RKSSKSPSPPTNRTTQGESPKTSSSGH-GQHSSRTAVRRSASFSSSQRRTSESESRSKP 210 >SB_45417| Best HMM Match : Homeobox (HMM E-Value=5.1e-09) Length = 216 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +1 Query: 4 APAPTYPLQFTQP--AQSGAF 60 APAP YP FT P A GAF Sbjct: 51 APAPVYPSYFTSPRLATEGAF 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,551,287 Number of Sequences: 59808 Number of extensions: 66459 Number of successful extensions: 239 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 214 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 239 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -