BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_G10 (592 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces p... 27 2.7 SPCC550.11 |||karyopherin|Schizosaccharomyces pombe|chr 3|||Manual 26 3.6 >SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 226 Score = 26.6 bits (56), Expect = 2.7 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 161 ENVFNSTGAEWKIQKRLFTQNNIGQTKFYFECIHKVDNVLFIFV-ECITSSF 9 E +F++ I ++F +++I F+ C H V N LF+F IT+SF Sbjct: 17 EVLFSAISFGISIYIKVFGRSSI--VTFFLLCFHLVPNALFLFPWTIITTSF 66 >SPCC550.11 |||karyopherin|Schizosaccharomyces pombe|chr 3|||Manual Length = 1029 Score = 26.2 bits (55), Expect = 3.6 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = -1 Query: 133 NGRSRSDFSLKTILDKPSFILSV 65 N R++++ SLK + +PSF+L+V Sbjct: 16 NTRTKAELSLKQLEKEPSFVLAV 38 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,383,824 Number of Sequences: 5004 Number of extensions: 43171 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -