BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_G08 (621 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 1.7 SB_8875| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_17034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) 29 2.3 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 29 3.0 SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_39205| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.5e-09) 29 4.0 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 28 5.3 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 28 7.0 SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) 27 9.3 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.9 bits (64), Expect = 1.7 Identities = 25/63 (39%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -1 Query: 396 LPAAVT-LSPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAK 220 LPAAV + P V+ TP L ATP VA LVK+K P L I K Sbjct: 256 LPAAVPPIKTKPAAPSPVKATPTVAPLVKATPMVAP-----LVKAKLPQPLRILYICEEK 310 Query: 219 GTL 211 GT+ Sbjct: 311 GTV 313 >SB_8875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 328 RPRSKSHGYTHPRVRRQGDSC 390 RP S+SHG HPRV D+C Sbjct: 92 RPTSQSHGNRHPRVPIDKDNC 112 >SB_17034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/39 (46%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 231 LPAKGTLTPA-PEVPSELSVRAPCASLRTLELVNSSGSS 118 L AKG L+ P E +RAPC+SL E SSG S Sbjct: 13 LEAKGRLSERRPSAKCESILRAPCSSLEDKESDESSGLS 51 >SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) Length = 646 Score = 29.5 bits (63), Expect = 2.3 Identities = 24/95 (25%), Positives = 45/95 (47%) Frame = +2 Query: 134 LTSSRVRRDAHGALTLNSDGTSGAGVKVPFAGNDKNIVSAIGSLDLTNRQKLGAATAGVA 313 L R +DA + D T ++ F N + V G ++ R + + T ++ Sbjct: 398 LGDPRYMKDADKVVKKMVDQTHSNNLR-KFIDNRTHPVKYYGPINY--RTDVTSGTTHLS 454 Query: 314 LDNVNGHGVSLTDTHIPGFGDKVTAAGKVNLFHND 418 + + +G+GVSLT + FG K+ + K+ + +ND Sbjct: 455 VVDADGNGVSLTSSINKYFGSKIRSK-KLGIIYND 488 >SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1506 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +2 Query: 368 FGDKVTAAGKVNLFH---NDYHDITAKAFATRNMPDIANVPNFNTV 496 FGDK A + FH ND D + + TR + D++ +P + TV Sbjct: 587 FGDKWIGANTIRAFHHTDNDGIDASENSNLTRIIFDLSTLPMYETV 632 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 331 PRSKSHGYTHPRVRRQGDSC 390 P + SH YTH VR GD+C Sbjct: 260 PHALSHNYTHLAVRYYGDAC 279 >SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 331 PRSKSHGYTHPRVRRQGDSC 390 P + SH YTH VR GD+C Sbjct: 260 PHALSHNYTHLAVRYYGDAC 279 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 29.1 bits (62), Expect = 3.0 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = -1 Query: 396 LPAAVTL-SPNPGMCVSVRLTPWPFTLSSATPAVAAPSFCLLVKSKEPIALTIFLSLPAK 220 LP V+L S PG TP P +L+S TP+ + L K+ P++L+ S P Sbjct: 1042 LPVPVSLTSKTPGPVSLTSKTPGPVSLTSKTPSPVS----LTSKTPGPVSLSSKTSGPVS 1097 Query: 219 GT-LTPAP 199 T TP P Sbjct: 1098 LTSKTPGP 1105 >SB_39205| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.5e-09) Length = 1084 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +1 Query: 322 CKRPRSKSHGYTHPRVRRQGDSCRQS--ESLPQRLPRHHSEGFRHQK 456 C P K+ HP R+ GD+C E + + LP H E R K Sbjct: 361 CSEPCPKTLECGHPCARKCGDTCTSKCIEKIEKTLPCGHKETVRCYK 407 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 28.3 bits (60), Expect = 5.3 Identities = 22/83 (26%), Positives = 42/83 (50%) Frame = -3 Query: 616 TLEEVQLSVQGVIVTIDEVRVSGGR*CTNLIFEHIVYSATDSVEVGYISDIWHISGGESL 437 T ++V L+ + V +T D+V ++ +L + + TD V + +D++ S G L Sbjct: 458 TGDDVHLTSEHVHLTSDDVHLTSDD--VHLTSDD--GNLTDDVHLTS-NDVYLTSDGVHL 512 Query: 436 RCDVVVIVVEEIHFAGSCHLVSE 368 D V + +++H G HL S+ Sbjct: 513 TSDDVHLTGDDVHLTGDVHLTSD 535 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 27.9 bits (59), Expect = 7.0 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +1 Query: 343 SHGYTHPRVRRQGDSCRQSESLPQRLPRHHSEGFRHQKYARYR*CTQLQHC 495 +H T+PR R Q D C LP+ P + +A Y C +L HC Sbjct: 1039 AHYLTYPR-RDQRDHCALPR-LPKTRPLRTTSLTPEATFAHYLTCPRLDHC 1087 >SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1432 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 8/56 (14%) Frame = +1 Query: 328 RPRSKSHGYTHPRVRRQGDSCRQSESLPQR--------LPRHHSEGFRHQKYARYR 471 R R + HG HPR + +S+ L R LPR + + +R + + R R Sbjct: 1323 RDRDRYHGSEHPRSHERSSDYSRSKDLHPRSYDRGTDHLPRSYEKSYRREDHHRSR 1378 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,551,815 Number of Sequences: 59808 Number of extensions: 416943 Number of successful extensions: 1267 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1265 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -