BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_G06 (622 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024776-13|AAK68483.1| 374|Caenorhabditis elegans Nuclear horm... 29 2.7 AL032630-10|CAA21566.1| 396|Caenorhabditis elegans Hypothetical... 28 6.2 >AC024776-13|AAK68483.1| 374|Caenorhabditis elegans Nuclear hormone receptor familyprotein 122 protein. Length = 374 Score = 29.1 bits (62), Expect = 2.7 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +2 Query: 65 VFLFYKEDHNFFSFFIESRII 127 +++ K+DH+FF +F+ES+ I Sbjct: 354 MYIMNKQDHSFFKYFVESKRI 374 >AL032630-10|CAA21566.1| 396|Caenorhabditis elegans Hypothetical protein Y62H9A.10 protein. Length = 396 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 283 PD*FVDNICDKYQSILDYF---LVLRRN*CTVRVEI*VQTIIYLNL 411 P FVDNIC + S+L +F L +R C V + I + IY+ + Sbjct: 165 PPKFVDNICFNFSSVLPWFRNYLAYQRMLC-VFIPIIIYFFIYIRM 209 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,902,017 Number of Sequences: 27780 Number of extensions: 243676 Number of successful extensions: 548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1353389824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -