BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_F20 (398 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 5.2 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 6.9 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.0 bits (42), Expect = 5.2 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = -2 Query: 262 LRLILILFDVVTRLFNKHVTAVDADQENRH*EQLSEHLR 146 ++ +L+L +VT + K V ++ ADQ E+L++++R Sbjct: 3 VKSVLLLITIVTFVALKPVKSMSADQV----EKLAKNMR 37 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 20.6 bits (41), Expect = 6.9 Identities = 10/40 (25%), Positives = 15/40 (37%) Frame = +2 Query: 233 YIEQYEDQPEQWANSRVRRQAGALTINSDGTSGAMVKVPI 352 Y + E W N+ V R NS+ + + V I Sbjct: 264 YFHSLASRVESWVNTSVIRNYTLFNENSEAAARSFVPFSI 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,497 Number of Sequences: 438 Number of extensions: 1618 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -