BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_F19 (405 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 7e-07 SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 33 0.089 SB_47264| Best HMM Match : Ion_trans (HMM E-Value=1.19951e-42) 27 5.8 SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) 27 5.8 SB_54865| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 50.0 bits (114), Expect = 7e-07 Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 1/28 (3%) Frame = +2 Query: 125 CGVISPRFDVPINDIERW-TNLLPSRQF 205 CGVISPRFDV + DIE+W +NLLPSRQF Sbjct: 1 CGVISPRFDVGVRDIEQWASNLLPSRQF 28 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 33.1 bits (72), Expect = 0.089 Identities = 23/49 (46%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 2 SKVIVKFLTVMMKHGYIGEFEIVDDHRAGKIVVN-LTGRLNKCGVISPR 145 SKVIVKFLTVMMKH V R G++V +G L+ GV+ R Sbjct: 31 SKVIVKFLTVMMKH--------VAQPRIGEMVTRPCSGALSAAGVVVTR 71 >SB_47264| Best HMM Match : Ion_trans (HMM E-Value=1.19951e-42) Length = 1172 Score = 27.1 bits (57), Expect = 5.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 270 RCFLLASS*SMMPPLVVRTRYPNCL 196 R + S S++PPL VRT PN L Sbjct: 331 RSLIYISGTSLVPPLTVRTETPNTL 355 >SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) Length = 549 Score = 27.1 bits (57), Expect = 5.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 134 ISPRFDVPINDIERWTNLLPSRQFGYL 214 ISP F VP D ++ ++L+PS+Q +L Sbjct: 381 ISPIFTVPKKDGKKKSSLIPSQQITFL 407 >SB_54865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 26.6 bits (56), Expect = 7.7 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 217 SHNKWWHHGS*GSQKETSWRKN-SRLLFLSLFNTSENTF 330 SHN+ HH Q + WR + SR L LS++ +F Sbjct: 47 SHNESNHHAEHNLQSDAQWRHDTSRELTLSVYQELVRSF 85 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,410,818 Number of Sequences: 59808 Number of extensions: 267188 Number of successful extensions: 481 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -