BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0001_F14 (452 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 2.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 3.8 AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. 23 5.0 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 2.2 Identities = 17/69 (24%), Positives = 25/69 (36%) Frame = +3 Query: 120 AKLGHLTGYHHCTLLVNANKADLSKALAKRETHATASTRSEVANLTDLDNRVTVESLQTA 299 ++ G L G NA K S + T+ T SE+ L R + Sbjct: 523 SQAGGLAGSERTGTGTNAGKTTFSNIIGSSGPSVTSCTGSEIDKQVGLWERRVKGLRRMI 582 Query: 300 LGYEYLRTP 326 LG+E + P Sbjct: 583 LGWEQTKPP 591 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 3.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 273 LDYPSRSDSPPRTASMPSRES 211 +D S+ DS P+T+S RES Sbjct: 342 IDTYSQKDSKPKTSSSTERES 362 >AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. Length = 156 Score = 23.0 bits (47), Expect = 5.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 270 RVTVESLQTALGYEYL 317 RV + SLQ + YEYL Sbjct: 82 RVVIASLQNIVAYEYL 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 444,171 Number of Sequences: 2352 Number of extensions: 8230 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -